| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the C-terminus, Recombinant Mouse CD28 is produced by our Mammalian expression system and the target gene encoding Asn20-Lys149 is expressed with a Fc |
| Molecular Weight: |
43 kD |
| UniProt number: |
P31041 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
TP44 (C-Fc-6His), CD28 |
| Short name: |
TP44 (C-Fc-6His), Recombinant Mouse CD28 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
, TP44 (C-fragment c-6His), recombinant Mouse CD28 molecule |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD28 and IDBG-643371 and ENSBTAG00000007445 and 281050, CD28 and IDBG-79183 and ENSG00000178562 and 940, Cd28 and IDBG-159608 and ENSMUSG00000026012 and 12487, Cell surfaces, Tp44, identical protein binding, this GO :0001772 and immunological synapse and cellular component this GO :0002020 and protease binding and molecular function this GO :0002863 and positive regulation of inflammatory response to antigenic stimulus and biological process this GO :0005070 and SH3/SH2 adaptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006959 and humoral immune response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009967 and positive regulation of signal transduction and biological process this GO :0015026 and coreceptor activity and molecular function this GO :0016032 and viral process and biological process this GO :0031295 and T cell costimulation and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042089 and cytokine biosynthetic process and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042802 and identical protein binding and molecular function this GO :0045060 and negative thymic T cell selection and biological process this GO :0045066 and regulatory T cell differentiation and biological process this GO :0045070 and positive regulation of viral genome replication and biological process this GO :0045086 and positive regulation of interleukin-2 biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045727 and positive regulation of translation and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046641 and positive regulation of alpha-beta T cell proliferation and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048304 and positive regulation of isotype switching to IgG isotypes and biological process this GO :0050690 and regulation of defense response to virus by virus and biological process this GO :0050852 and T cell receptor signaling pathway and biological process this GO :0097190 and apoptotic signaling pathway and biological process, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0005070 : SH3/SH2 adaptor activity and also this GO :0005515 : protein binding and also this GO :0015026 : coreceptor activity and also this GO :0042802 : identical protein binding, this GO :0005070 : SH3/SH2 adaptor activity, this GO :0005515 : protein binding, this GO :0015026 : coreceptor activity, this GO :0042802 : identical protein binding, CD28 molecule |
| Identity: |
1653 |
| Gene: |
CD28 |
More about : CD28 |
| Long gene name: |
CD28 molecule |
| Synonyms gene name: |
CD28 antigen (Tp44) |
| Synonyms name: |
T-cell-specific surface glycoprotein |
| Locus: |
2q33, 2 |
| Discovery year: |
1988-05-11 |
| GenBank acession: |
J02988 |
| Entrez gene record: |
940 |
| Pubmed identfication: |
1355979 |
| RefSeq identity: |
NM_006139 |
| Classification: |
CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000132878 |