Recombinant Mouse Placenta Growth Factor, PGF, PIGF (C-6His)

Contact us
Catalog number: CI37
Price: 384 €
Supplier: acr
Product name: Recombinant Mouse Placenta Growth Factor, PGF, PIGF (C-6His)
Quantity: 0,1 mg
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Placenta growth factor is produced by our Mammalian expression system and the target gene encoding Val19-Pro158 is expressed with a 6His tag at the C-terminus
Molecular Weight: 16, 9 kD
UniProt number: P49764
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: PGF, PIGF (C-6His), Placenta Growth Factor
Short name: PGF, PIGF (C-6His), Recombinant Mouse Placenta Growth Factor
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: PGF, PIGF (C-6His), recombinant Mouse Placenta Growth Factor
Alternative technique: rec
Identity: 8962
Gene: PIGF | More about : PIGF
Long gene name: phosphatidylinositol glycan anchor biosynthesis class F
Synonyms gene name: class F , phosphatidylinositol glycan
Locus: 2p21
Discovery year: 1993-10-28
Entrez gene record: 5281
Pubmed identfication: 8575782 8463218
RefSeq identity: NM_173074
Classification: Phosphatidylinositol glycan anchor biosynthesis
Havana BLAST/BLAT: OTTHUMG00000128816

Related Products :

CI37 Recombinant Mouse Placenta Growth Factor, PGF, PIGF (C-6His) 1 mg 2486 € novo mouse
GWB-F105D8 Placenta Growth Factor-1 (PIGF-1) 1 vial 1456 € genways human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
AM50307PU-N anti-Placenta growth factor / PGF Antibody 0,2 mg 616 € acr human
AM50307PU-S anti-Placenta growth factor / PGF Antibody 0,1 mg 514 € acr human
AM50307PU-T anti-Placenta growth factor / PGF Antibody 20 Вµg 282 € acr human
AP01135BT-N anti-Placenta growth factor / PGF Antibody 50 Вµg 543 € acr human
AP01135BT-S anti-Placenta growth factor / PGF Antibody 25 Вµg 384 € acr human
AP01135PU-N anti-Placenta growth factor / PGF Antibody 0,1 mg 543 € acr human
AP01135PU-S anti-Placenta growth factor / PGF Antibody 50 Вµg 384 € acr human
AP31725PU-L anti-Placenta growth factor / PGF Antibody 0,2 mg 587 € acr human
AP31725PU-N anti-Placenta growth factor / PGF Antibody 0,1 mg 442 € acr human
AP31725PU-S anti-Placenta growth factor / PGF Antibody 50 Вµg 456 € acr human
AR26011PU-L anti-Placenta growth factor / PGF Antibody 20 Вµg 761 € acr human
AR26011PU-N anti-Placenta growth factor / PGF Antibody 5 Вµg 413 € acr human
AR26011PU-S anti-Placenta growth factor / PGF Antibody 2 Вµg 311 € acr human
AR31058PU-L anti-Placenta growth factor / PGF Antibody 20 Вµg 761 € acr human
AR31058PU-N anti-Placenta growth factor / PGF Antibody 5 Вµg 413 € acr human
AR31058PU-S anti-Placenta growth factor / PGF Antibody 2 Вµg 311 € acr human
AR31145PU-N anti-Placenta growth factor / PGF Antibody 25 Вµg 384 € acr human
AR31145PU-S anti-Placenta growth factor / PGF Antibody 5 Вµg 253 € acr human
BB-PA1066 anti-Placenta growth factor / PGF Antibody 0,1 mg 471 € acr human
DA3508X anti-Placenta growth factor / PGF Antibody 20 Вµg 761 € acr human
DM3524 anti-Placenta growth factor / PGF Antibody 0,1 mg 558 € acr human
DM3526 anti-Placenta growth factor / PGF Antibody 0,1 mg 529 € acr human
DP3502 anti-Placenta growth factor / PGF Antibody 0,2 mg 471 € acr human
DP3502S anti-Placenta growth factor / PGF Antibody 0,1 mg 384 € acr human
DP3503 anti-Placenta growth factor / PGF Antibody 0,2 mg 471 € acr human
DP3503P anti-Placenta growth factor / PGF Antibody 50 Вµg 427 € acr human
DP3503S anti-Placenta growth factor / PGF Antibody 0,1 mg 384 € acr human