Recombinant Mouse Interleukin-13, IL-13 (Ser26-Phe131)

Contact us
Catalog number: CH18
Price: Ask price €
Supplier: genways bulk
Product name: Recombinant Mouse Interleukin-13, IL-13 (Ser26-Phe131)
Quantity: bulk
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1755€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Interleukin-13 is produced by our E, coli expression system and the target gene encoding Ser26-Phe131 is expressed
Molecular Weight: 11, 7 kD
UniProt number: P20109
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: IL-13 (Ser26-Phe131), Interleukin-13
Short name: IL-13 (Ser26-Phe131), Recombinant Mouse Interleukin-13
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: Interleukin-13 (Ser26-Phe131), recombinant Mouse Interleukin-13
Alternative technique: rec
Identity: 5973
Gene: IL13 | More about : IL13
Long gene name: interleukin 13
Synonyms: P600 IL-13 ALRH BHR1 MGC116786 MGC116788 MGC116789
Synonyms name: allergic rhinitis Bronchial hyperresponsiveness-1 (bronchial asthma)
Locus: 5q31, 1
Discovery year: 1993-04-07
GenBank acession: U31120
Entrez gene record: 3596
RefSeq identity: NM_002188
Classification: Interleukins
Havana BLAST/BLAT: OTTHUMG00000059723

Related Products :

CH18 Recombinant Mouse Interleukin-13, IL-13 (Ser26-Phe131) 1 mg 2486 € novo mouse
C088 Recombinant Mouse Interleukin-13, IL-13 (Pro22-Phe131) 1 mg 3145 € novo mouse
CD57 Recombinant Mouse Interleukin-13, IL-13 (Ser26-Phe131,C-6His) 1 mg 3145 € novo mouse
A03A0211 anti-ANXA2 (Phospho-Ser26) Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
OBT0092G Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; frozen, ELISA/WB/flow 0.5 mg Ask price € accurate-monoclonals mouse
OBT0092Z Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; frozen, flow/ELISA/WB/Functional Assays: Azide Free 1 mg Ask price € accurate-monoclonals mouse
OBT0092 Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; frozen, IH/ELISA/WB/IA 0.25 mg Ask price € accurate-monoclonals mouse
OBT0092R Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, RPE 500ul Ask price € accurate-monoclonals mouse
OBT0088G Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse 0.5 mg Ask price € accurate-monoclonals mouse
OBT0088Z Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Azide Free 1 mg Ask price € accurate-monoclonals mouse
OBT0088B Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Biotin 200ug Ask price € accurate-monoclonals mouse
OBT0088BB Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Biotin 0.5 mg Ask price € accurate-monoclonals mouse
OBT0088F Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, FITC 0.1 mg Ask price € accurate-monoclonals mouse
OBT0088 Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; ELISA/WB/IA 0.25 mg Ask price € accurate-monoclonals mouse
OBT0088R Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, RPE 500ul Ask price € accurate-monoclonals mouse
OBT0090 Interleukin 5 (IL-5), natural & recombinant, Clone: TRFK5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; ELISA/WB/IA 0.5 mg Ask price € accurate-monoclonals mouse
OBT0090R Interleukin 5 (IL-5), natural & recombinant, Clone: TRFK5, Rat Mouse Monoclonal antibody-Mouse, RPE 500ul Ask price € accurate-monoclonals mouse
YM5036 Interleukin 6 (IL-6), Bioactivity inhibitor, native & recombinant, Clone: F5, Rat Mouse Monoclonal antibody-Mouse 3 ml Ask price € accurate-monoclonals mouse
YM5017 Interleukin 6 (IL-6), natural & recombinant, Clone: MP5-32C11, Mouse Monoclonal antibody-Mouse (NO X w/Human or Rat); IA/IP/Inhibition 0.1mg 1004 € accurate-monoclonals rat
MBS624348 IL6ST, phosphorylated (Tyr905) (Interleukin-6 Receptor Subunit beta, IL-6R-beta, Interleukin-6 Signal Transducer, Membrane Glycoprotein 130, gp130, CDw130, Oncostatin-M Receptor Subunit alpha, CD130, IL-6 Receptor Subunit beta, IL-6R Subunit beta) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS621212 Interleukin 1 Receptor AcP, C2 (IL1RacP, IL-1 Receptor Accessory Protein, IL-1RAP, FLJ37788, IL1R3, Interleukin 1 Accessory Protein) Antibody 100ug 857 € MBS Polyclonals_1 human
MBS611936 Interleukin 18BP (IL-18BP, IL18BPa, Interleukin 18 Binding Protein, Tadekinig-alfa, interferon-gamma inducing factor, IGIF) Antibody 100ug 597 € MBS Polyclonals_1 human
MBS612345 Interleukin 18BP (IL-18BP, IL18BPa, Interleukin 18 Binding Protein, Tadekinig-alfa, interferon-gamma inducing factor, IGIF) Antibody 50ug 382 € MBS Polyclonals_1 human
GWB-2163DF INTERLEUKIN 6 CROSS REACTIVE WITH RAT INTERLEUKIN 6 1 x 1 vial 752 € genways human
MBS622653 IRAK4, CT (interleukin-1 receptor-associated kinase 4, Interleukin-1 receptor-associated kinase 4, IPD1, IRAK-4, NY-REN-64, NY-REN-64 antigen, REN64) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS617327 NFIL3 (E4 Promoter Binding Protein 4, E4BP4, E4BP4 Protein, Interleukin 3 Binding Protein 1, IL3BP1, Interleukin 3 Promoter Transcriptional Activator, NFIL3A, Nuclear Factor Interleukin 3 Regulated, Transcriptional Activator NF-IL3A) Antibody 100ug 591 € MBS Polyclonals_1 human
MAS612p Interleukin 2 (IL-2), natural & recombinant, Clone: GE14, Mouse Monoclonal antibody-Human; frozen, IH/ELISA/IA 0.5 mg Ask price € accurate-monoclonals human
MAS614p Interleukin 4 (IL-4), natural & recombinant, Clone: IL-4-5, Mouse Monoclonal antibody-Human, Inhibits activity; frozen, IH/ELISA/IA 0.2mg Ask price € accurate-monoclonals human
GWB-P0138H Mouse Interleukin-2, 21-169 aa, Recombinant Protein bulk Ask price € genways bulk mouse
GWB-9BC459 Recombinant Mouse Interleukin-1 beta His Tag bulk Ask price € genways bulk mouse