Recombinant Mouse Interleukin-33, IL-33

Contact us
Catalog number: CG73
Price: 2283 €
Supplier: novo
Product name: Recombinant Mouse Interleukin-33, IL-33
Quantity: 500 µg
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Interleukin-33 is produced by our E, coli expression system and the target gene encoding Ser109-Ile266 is expressed
Molecular Weight: 17, 6 kD
UniProt number: Q8BVZ5
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: IL-33, Interleukin-33
Short name: IL-33, Recombinant Mouse Interleukin-33
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: Interleukin-33, recombinant Mouse Interleukin-33
Alternative technique: rec

Related Products :

OBT0092G Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; frozen, ELISA/WB/flow 0.5 mg Ask price € accurate-monoclonals mouse
OBT0092Z Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; frozen, flow/ELISA/WB/Functional Assays: Azide Free 1 mg Ask price € accurate-monoclonals mouse
OBT0092 Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; frozen, IH/ELISA/WB/IA 0.25 mg Ask price € accurate-monoclonals mouse
OBT0092R Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, RPE 500ul Ask price € accurate-monoclonals mouse
OBT0088G Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse 0.5 mg Ask price € accurate-monoclonals mouse
OBT0088Z Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Azide Free 1 mg Ask price € accurate-monoclonals mouse
OBT0088B Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Biotin 200ug Ask price € accurate-monoclonals mouse
OBT0088BB Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Biotin 0.5 mg Ask price € accurate-monoclonals mouse
OBT0088F Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, FITC 0.1 mg Ask price € accurate-monoclonals mouse
OBT0088 Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; ELISA/WB/IA 0.25 mg Ask price € accurate-monoclonals mouse
OBT0088R Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, RPE 500ul Ask price € accurate-monoclonals mouse
OBT0090 Interleukin 5 (IL-5), natural & recombinant, Clone: TRFK5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; ELISA/WB/IA 0.5 mg Ask price € accurate-monoclonals mouse
OBT0090R Interleukin 5 (IL-5), natural & recombinant, Clone: TRFK5, Rat Mouse Monoclonal antibody-Mouse, RPE 500ul Ask price € accurate-monoclonals mouse
YM5036 Interleukin 6 (IL-6), Bioactivity inhibitor, native & recombinant, Clone: F5, Rat Mouse Monoclonal antibody-Mouse 3 ml Ask price € accurate-monoclonals mouse
YM5017 Interleukin 6 (IL-6), natural & recombinant, Clone: MP5-32C11, Mouse Monoclonal antibody-Mouse (NO X w/Human or Rat); IA/IP/Inhibition 0.1mg 1004 € accurate-monoclonals rat
MBS624348 IL6ST, phosphorylated (Tyr905) (Interleukin-6 Receptor Subunit beta, IL-6R-beta, Interleukin-6 Signal Transducer, Membrane Glycoprotein 130, gp130, CDw130, Oncostatin-M Receptor Subunit alpha, CD130, IL-6 Receptor Subunit beta, IL-6R Subunit beta) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS621212 Interleukin 1 Receptor AcP, C2 (IL1RacP, IL-1 Receptor Accessory Protein, IL-1RAP, FLJ37788, IL1R3, Interleukin 1 Accessory Protein) Antibody 100ug 857 € MBS Polyclonals_1 human
MBS611936 Interleukin 18BP (IL-18BP, IL18BPa, Interleukin 18 Binding Protein, Tadekinig-alfa, interferon-gamma inducing factor, IGIF) Antibody 100ug 597 € MBS Polyclonals_1 human
MBS612345 Interleukin 18BP (IL-18BP, IL18BPa, Interleukin 18 Binding Protein, Tadekinig-alfa, interferon-gamma inducing factor, IGIF) Antibody 50ug 382 € MBS Polyclonals_1 human
GWB-2163DF INTERLEUKIN 6 CROSS REACTIVE WITH RAT INTERLEUKIN 6 1 x 1 vial 752 € genways human
MBS622653 IRAK4, CT (interleukin-1 receptor-associated kinase 4, Interleukin-1 receptor-associated kinase 4, IPD1, IRAK-4, NY-REN-64, NY-REN-64 antigen, REN64) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS617327 NFIL3 (E4 Promoter Binding Protein 4, E4BP4, E4BP4 Protein, Interleukin 3 Binding Protein 1, IL3BP1, Interleukin 3 Promoter Transcriptional Activator, NFIL3A, Nuclear Factor Interleukin 3 Regulated, Transcriptional Activator NF-IL3A) Antibody 100ug 591 € MBS Polyclonals_1 human
MAS612p Interleukin 2 (IL-2), natural & recombinant, Clone: GE14, Mouse Monoclonal antibody-Human; frozen, IH/ELISA/IA 0.5 mg Ask price € accurate-monoclonals human
MAS614p Interleukin 4 (IL-4), natural & recombinant, Clone: IL-4-5, Mouse Monoclonal antibody-Human, Inhibits activity; frozen, IH/ELISA/IA 0.2mg Ask price € accurate-monoclonals human
GWB-P0138H Mouse Interleukin-2, 21-169 aa, Recombinant Protein bulk Ask price € genways bulk mouse
GWB-9BC459 Recombinant Mouse Interleukin-1 beta His Tag bulk Ask price € genways bulk mouse
GWB-4B6009 Recombinant Mouse Interleukin-1 Receptor Antagonist bulk Ask price € genways bulk mouse
C697 Recombinant Mouse Interleukin-10, IL-10 10 µg 202 € novo mouse
GWB-1C46AD Recombinant Mouse Interleukin-11 bulk Ask price € genways bulk mouse
C757 Recombinant Mouse Interleukin-11, IL-11 (C-6His) 500 µg 2283 € novo mouse