Recombinant Mouse VEGF-D, PIGF (C-6His)

Contact us
Catalog number: CD18
Price: 916 €
Supplier: accurate-monoclonals
Product name: Recombinant Mouse VEGF-D, PIGF (C-6His)
Quantity: 0.1mg
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Vascular Endothelial Growth Factor D is produced by our Mammalian expression system and the target gene encoding Phe98-Ser206 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 13
UniProt number: P97946
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: FYDTETLKVIDEEWQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYISKQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: PIGF (C-6His), VEGF-D
Short name: PIGF (C-6His), Recombinant Mouse VEGF-D
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: PIGF (C-6His), recombinant Mouse VEGF-D
Alternative technique: rec
Identity: 3708
Gene: VEGFD | More about : VEGFD
Long gene name: vascular endothelial growth factor D
Synonyms gene: FIGF
Synonyms gene name: c-fos induced growth factor (vascular endothelial growth factor D)
Synonyms: VEGF-D
Locus: Xp22, 2
Discovery year: 1997-03-27
GenBank acession: AJ000185
Entrez gene record: 2277
Pubmed identfication: 9479493
RefSeq identity: NM_004469
Classification: VEGF family
Havana BLAST/BLAT: OTTHUMG00000021175
Locus Specific Databases: Mental Retardation database

Related Products :

CD18 Recombinant Mouse VEGF-D, PIGF (C-6His) 1 mg 2283 € novo mouse
CI37 Recombinant Mouse Placenta Growth Factor, PGF, PIGF (C-6His) 1 mg 2486 € novo mouse
PR15032-5 anti-VEGF/PIGF Heterodimer Antibody 5 Вµg 630 € acr human
PR15032CF-5 anti-VEGF / PIGF Heterodimer (Carrier Free) Antibody 5 Вµg 630 € acr human
GENTAUR-58b8c76bedbbf Mouse Phosphatidylinositol-glycan biosynthesis class F protein (Pigf) 1000ug 1619 € MBS Recombinant Proteins mouse
GENTAUR-58b8c76c66ac3 Mouse Phosphatidylinositol-glycan biosynthesis class F protein (Pigf) 1000ug 2122 € MBS Recombinant Proteins mouse
GENTAUR-58b9c871538e1 Mouse Phosphatidylinositol-glycan biosynthesis class F protein (Pigf) 1000ug 1619 € MBS Recombinant Proteins mouse
GENTAUR-58b9c871acdb7 Mouse Phosphatidylinositol-glycan biosynthesis class F protein (Pigf) 1000ug 2122 € MBS Recombinant Proteins mouse
CJ93 Recombinant Human VEGF Receptor 1, VEGF R1, FLT-1 (C-Fc) 500 µg 1115 € novo human
CJ92 Recombinant Human VEGF Receptor 2, VEGF R2, FLK-1, KDR (C-Fc) 500 µg 1115 € novo human
abx217765 Anti-PIGF Antibody 200 μg 369 € abbex human
abx162646 Anti-PIGF Blocking Peptide 1 mg 282 € abbex human
abx928563 Anti-PIGF siRNA inquire 50 € abbex human
abx928564 Anti-PIGF siRNA inquire 50 € abbex human
AE27512HU-48 ELISA test for Human Phosphatidylinositol-glycan biosynthesis class F protein (PIGF) 1x plate of 48 wells 373 € abebio human
AE27512HU-96 Human Phosphatidylinositol-glycan biosynthesis class F protein (PIGF) ELISA Kit 1x plate of 96 wells 612 € abebio human
GWB-MN427D PIGF antibody 1 vial 521 € genways human
MBS535816 PIGF antibody 50ug 404 € MBS Polyclonals_1 human
GWB-F105D8 Placenta Growth Factor-1 (PIGF-1) 1 vial 1456 € genways human
DEVAS1721 Vascular Endothelial Growth Factor (VEGF), Clone: mxsghk-VEGF, Mouse Monoclonal antibody-Human; ELISA 200ug 448 € accurate-monoclonals human
C699 Recombinant Human VEGF-A, VEGF121 (C-6His) 50 µg 496 € novo human
C546 Recombinant Human VEGF-C (C-6His) 500 µg 1613 € novo human
C498 Recombinant Human VEGF-D, FIGF (C-6His) 500 µg 1613 € novo human
AP26032PU-L anti-VEGF-B (VEGF-B167) Antibody 0,2 mg 587 € acr human
AP26032PU-N anti-VEGF-B (VEGF-B167) Antibody 0,1 mg 442 € acr human
DA3520 anti-VEGF-C / Flt4-L (VEGF-C152S) Antibody 5 Вµg 326 € acr human
DA3520X anti-VEGF-C / Flt4-L (VEGF-C152S) Antibody 20 Вµg 456 € acr human
MBS615440 Vascular Endothelial Growth Factor C, Propeptide (VEGF-C, VEGF-A, Vascular permeability factor, VPF) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS612096 Vascular Endothelial Growth Factor, Mature (VEGF-C, VEGF-A, Vascular permeability factor, VPF) 100ug 663 € MBS Polyclonals_1 human
OBT1170 FLK-1 {mouse}, KDR {human}, VEGF receptor, Clone: CH-11, Mouse Monoclonal antibody-Human, Mouse; IB/ELISA 0.1mg 916 € accurate-monoclonals mouse