Recombinant Mouse Ephrin-A4, EFNA4 (C-Fc)

Contact us
Catalog number: CC50
Price: 370 €
Supplier: MBS Polyclonals
Product name: Recombinant Mouse Ephrin-A4, EFNA4 (C-Fc)
Quantity: 100ug
Other quantities: 1 mg 1014€ 50 µg 141€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Ephrin-A4 is produced by our Mammalian expression system and the target gene encoding Arg27-Gly176 is expressed with a Fc tag at the C-terminus
Molecular Weight: 44 kD
UniProt number: O08542
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: RHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: EFNA4 (C-Fc), Ephrin-A4
Short name: EFNA4 (C-Fc), Recombinant Mouse Ephrin-A4
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: EFNA4 (C-fragment c), recombinant Mouse Ephrin-A4
Alternative technique: rec
Identity: 3224
Gene: EFNA4 | More about : EFNA4
Long gene name: ephrin A4
Synonyms gene: EPLG4
Synonyms gene name: ephrin-A4
Synonyms: LERK4
Locus: 1q21, 3
Discovery year: 1995-01-17
GenBank acession: AJ006352
Entrez gene record: 1945
Pubmed identfication: 8660976
RefSeq identity: NM_005227
Classification: Ephrins
Havana BLAST/BLAT: OTTHUMG00000035309

Related Products :

CC50 Recombinant Mouse Ephrin-A4, EFNA4 (C-Fc) 1 mg 1014 € novo mouse
C466 Recombinant Human Ephrin-A4, EFNA4 (C-6His) 50 µg 212 € novo human
C480 Recombinant Human Ephrin-A4, EFNA4 (C-Fc-6His) 1 mg 506 € novo human
MBS623300 EphA4 (Ephrin Receptor Eph A4, Ephrin Receptor EphA4, Ephrin Type A Receptor 4, EPH Receptor A4, Eph A4, EPH-like Kinase 8, EK8, HEK8, Receptor Protein Tyrosine Kinase HEK8, SEK, TYRO1 Protein Tyrosine Kinase, Tyrosine Protein Kinase Receptor SEK, Tyrosin Antibody 50ug 928 € MBS Polyclonals_1 human
MBS610892 Ephrin-A5 (ephrin-A5, AF1, AL-1, EFL5, EPH- related receptor tyrosine kinase ligand 7, Ephrin-A5 precursor, EPLG7, GLC1M, LERK7, LERK-7, RAGS) Antibody 50ug 625 € MBS Polyclonals_1 human
MBS613613 Ephrin-A5 (ephrin-A5, AF1, AL-1, EFL5, EPH- related receptor tyrosine kinase ligand 7, Ephrin-A5 precursor, EPLG7, GLC1M, LERK7, LERK-7, RAGS) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS615500 Ephrin B3 (EFNB3, Ephrin B3 (EFL6, EPH-related receptor transmembrane ligand ELK-L3, EPH-related receptor tyrosine kinase ligand 8, Ephrin-B3, EPLG8, LERK8) Antibody 100ug 663 € MBS Polyclonals_1 human
GENTAUR-58bdc38c166b2 Anti- Ephrin A4 (EFNA4) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdc38c51b4b Anti- Ephrin A4 (EFNA4) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdc3e4bab6f Anti- Ephrin A4 (EFNA4) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc3e56ba11 Anti- Ephrin A4 (EFNA4) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdcfe0205cb Anti- Ephrin A4 (EFNA4) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdcfe0880b8 Anti- Ephrin A4 (EFNA4) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdd18111c85 Anti- Ephrin A4 (EFNA4) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd1c8a828e Anti- Ephrin A4 (EFNA4) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd2ad41f18 Anti- Ephrin A4 (EFNA4) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd49b68e85 Anti- Ephrin A4 (EFNA4) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdd7fb51cd3 Anti- Ephrin A4 (EFNA4) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bddbfd53ff3 Anti- Ephrin A4 (EFNA4) Antibody 100ug 603 € MBS Polyclonals human
abx572534 Anti-Human Ephrin A4 (EFNA4) ELISA Kit 96 tests 789 € abbex human
MBS616819 Ephrin A4 (EFNA4) Antibody 100ug 663 € MBS Polyclonals_1 human
EKU03922 Ephrin A4 (EFNA4) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
DL-EFNA4-Hu Human Ephrin A4 EFNA4 ELISA Kit 96T 904 € DL elisas human
MBS248974 PAb (IgG) to Human EFNA4 / Ephrin A4 Antibody 50ug 597 € MBS Polyclonals_1 human
PR27093-5 anti-Ephrin-A1 Ephrin-A1 / EFNA1 Antibody 5 Вµg 645 € acr human
AP06387PU-N anti-Ephrin-B1 (+Ephrin-B2) Antibody 0,1 mg 558 € acr human
MBS615633 Ephrin B1 (Ephrin-B1, ELK-L, EFL-3, Cek5-L, LERK-2) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS611262 Ephrin B2 (EPH-related receptor tyrosine kinase ligand 5, Ephrin-B2, EFNB2, EPLG5, HTK-L, HTK ligand, LERK5) Antibody 100ug 464 € MBS Polyclonals_1 human
MBS614848 Ephrin B2 (EPH-related receptor tyrosine kinase ligand 5, Ephrin-B2, EFNB2, EPLG5, HTK-L, HTK ligand, LERK5) Antibody 100ug 464 € MBS Polyclonals_1 human
GENTAUR-58be48b48b4ef Anti- EFNA4 Antibody 100ug 370 € MBS Polyclonals human