| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Natural cytotoxicity triggering receptor 1 is produced by our expression system and the target gene encoding Glu22-Asn255 is expressed |
| Molecular Weight: |
5 kD, 53 |
| UniProt number: |
Q8C567 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4 , Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
EKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPRPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQNDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
NCR1(C-6His), Natural Cytotoxicity Triggering Receptor 1 |
| Short name: |
NCR1(C-6His), Recombinant Mouse Natural Cytotoxicity Triggering Receptor 1 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
natural cytotoxicity triggering receptor 1(C-6His), recombinant Mouse Natural Cytotoxicity Triggering Receptor 1 |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD335 and LY94 and NK-p46 and NKP46, NCR1 and IDBG-641998 and ENSBTAG00000045529 and 369024, NCR1 and IDBG-69753 and ENSG00000189430 and 9437, Ncr1 and IDBG-137680 and ENSMUSG00000062524 and 17086, Plasma membranes, receptor signaling protein activity, this GO :0005057 and receptor signaling protein activity and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006968 and cellular defense response and biological process this GO :0007165 and signal transduction and biological process this GO :0016514 and SWI/SNF complex and cellular component this GO :0030101 and natural killer cell activation and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0042269 and regulation of natural killer cell mediated cytotoxicity and biological process, this GO :0005057 : receptor signaling protein activity, this GO :0005057 : receptor signaling protein activity, natural cytotoxicity triggering receptor 1 |
| Identity: |
6731 |
| Gene: |
NCR1 |
More about : NCR1 |
| Long gene name: |
natural cytotoxicity triggering receptor 1 |
| Synonyms gene: |
LY94 |
| Synonyms gene name: |
NK-p46) , lymphocyte antigen 94 (mouse) homolog (activating NK-receptor |
| Synonyms: |
NK-p46 NKP46 CD335 |
| Locus: |
19q13, 42 |
| Discovery year: |
1999-04-09 |
| GenBank acession: |
AJ001383 |
| Entrez gene record: |
9437 |
| Pubmed identfication: |
9730896 |
| Classification: |
CD molecules Immunoglobulin like domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000183212 |