Recombinant Mouse Granulocyte Colony-Stimulating Factor, G-CSF, CSF1

Contact us
Catalog number: CB75
Price: 579 €
Supplier: genways
Product name: Recombinant Mouse Granulocyte Colony-Stimulating Factor, G-CSF, CSF1
Quantity: 1 x 1 vial
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Colonies can be formed by stimulating factors or recombinant GM-CSF and CSFs activity expressed in Units compared to a standard
Molecular Weight: 18, 8 kD
UniProt number: P09920
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Gene: CSF3 | More about : CSF3
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CSF1, G-CSF, Granulocyte Colony-Stimulating Factor
Short name: CSF1, G-CSF, Recombinant Mouse Granulocyte Colony-Stimulating Factor
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: G-CSF, colony stimulating factor 1 (macrophage), recombinant Mouse Granulocyte Colony-Stimulating Factor
Alternative technique: rec
Alternative to gene target: CSF-1 and MCSF, CSF1 and IDBG-100920 and ENSG00000184371 and 1435, CSF1 and IDBG-635251 and ENSBTAG00000000283 and 281094, Csf1 and IDBG-185535 and ENSMUSG00000014599 and 12977, Extracellular, protein homodimerization activity, this GO :0001503 and ossification and biological process this GO :0001954 and positive regulation of cell-matrix adhesion and biological process this GO :0002158 and osteoclast proliferation and biological process this GO :0003006 and developmental process involved in reproduction and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005157 and macrophage colony-stimulating factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010743 and regulation of macrophage derived foam cell differentiation and biological process this GO :0010744 and positive regulation of macrophage derived foam cell differentiation and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030097 and hemopoiesis and biological process this GO :0030154 and cell differentiation and biological process this GO :0030225 and macrophage differentiation and biological process this GO :0030278 and regulation of ossification and biological process this GO :0030316 and osteoclast differentiation and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0032270 and positive regulation of cellular protein metabolic process and biological process this GO :0032946 and positive regulation of mononuclear cell proliferation and biological process this GO :0040018 and positive regulation of multicellular organism growth and biological process this GO :0042117 and monocyte activation and biological process this GO :0042476 and odontogenesis and biological process this GO :0042488 and positive regulation of odontogenesis of dentin-containing tooth and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043235 and receptor complex and cellular component this GO :0045087 and innate immune response and biological process this GO :0045651 and positive regulation of macrophage differentiation and biological process this GO :0045657 and positive regulation of monocyte differentiation and biological process this GO :0045672 and positive regulation of osteoclast differentiation and biological process this GO :0045860 and positive regulation of protein kinase activity and biological process this GO :0046579 and positive regulation of Ras protein signal transduction and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0048873 and homeostasis of number of cells within a tissue and biological process this GO :0060444 and branching involved in mammary gland duct morphogenesis and biological process this GO :0060611 and mammary gland fat development and biological process this GO :0060763 and mammary duct terminal end bud growth and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005157 : macrophage colony-stimulating factor receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0042803 : protein homodimerization activity, this GO :0005157 : macrophage colony-stimulating factor receptor binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0042803 : protein homodimerization activity, colony stimulating factor 1 (macrophage)
Identity: 2438
Long gene name: colony stimulating factor 3
Synonyms gene: GCSF G-CSF C17orf33
Synonyms gene name: chromosome 17 open reading frame 33 colony stimulating factor 3 (granulocyte)
Synonyms: MGC45931
Synonyms name: granulocyte colony stimulating factor pluripoietin filgrastim lenograstim
Locus: 17q21, 1
Discovery year: 2001-06-22
Entrez gene record: 1440
Pubmed identfication: 3499671 3501046
RefSeq identity: NM_172220
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000133247

Related Products :

CB75 Recombinant Mouse Granulocyte Colony-Stimulating Factor, G-CSF, CSF1 50 µg 496 € novo mouse
CB53 Recombinant Mouse Granulocyte Colony-Stimulating Factor, G-CSF, CSF1(C-6His) 10 µg 202 € novo mouse
C002 Recombinant Human Granulocyte Colony-Stimulating Factor, G-CSF 50 µg 496 € novo human
YV0341-01 Bovine Granulocyte-Macrophage Colony-Stimulating Factor, Clone: GM-CSF 17.2, Mouse Monoclonal antibody-Bovine 0.1 mg 354 € accurate-monoclonals bovine
YV0341-05 Bovine Granulocyte-Macrophage Colony-Stimulating Factor, Clone: GM-CSF 17.2, Mouse Monoclonal antibody-Bovine 0.5 mg Ask price € accurate-monoclonals bovine
YV0342-01 Bovine Granulocyte-Macrophage Colony-Stimulating Factor, Clone: GM-CSF 20.1, Mouse Monoclonal antibody-Bovine 0.1 mg 354 € accurate-monoclonals bovine
YV0342-05 Bovine Granulocyte-Macrophage Colony-Stimulating Factor, Clone: GM-CSF 20.1, Mouse Monoclonal antibody-Bovine 0.5 mg Ask price € accurate-monoclonals bovine
HYB181-LTD Granulocyte Colony Stimulating Factor (G-CSF), Clone Cocktail, Mouse Monoclonal antibody- 0.2mg Ask price € accurate-monoclonals mouse
DEVAS1726 Granulocyte Colony Stimulating Factor (G-CSF), Clone: mxsghk-GCSF, Mouse Monoclonal antibody-Human; ELISA 200ug 448 € accurate-monoclonals human
GWB-CA1107 Granulocyte-Colony Stimulating Factor (G-CSF) Mouse 1 vial 579 € genways mouse
YSRTMCA1689F Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF), Clone: BVD2-2C11, Rat Mouse Monoclonal antibody-Human, FITC; flow 0.1 mg Ask price € accurate-monoclonals human
YSRTMCA1689PE Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF), Clone: BVD2-2C11, Rat Mouse Monoclonal antibody-Human, RPE; flow vial Ask price € accurate-monoclonals human
YSRTMCA1828 Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF), Clone: CC305, Mouse Monoclonal antibody-Bovine; ELISA/WB 0.5 mg 617 € accurate-monoclonals bovine
HYB120-LTD Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF), Clone Cocktail, Mouse Monoclonal antibody- 0.2mg Ask price € accurate-monoclonals mouse
YM7033 Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF), Clone: HP1-22E9, Mouse Monoclonal antibody- 0.1mg 1004 € accurate-monoclonals mouse
MAS575p Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF), Clone: MG.72, Mouse Monoclonal antibody-Human; ELISA/WB/IA 200ug Ask price € accurate-monoclonals human
YM7034 Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF), Clone: MP1-13G6, Mouse Monoclonal antibody- 0.1mg 1004 € accurate-monoclonals mouse
DEVAS1725 Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF), Clone: mxsghk-GMCSF, Mouse Monoclonal antibody-Human; ELISA 200ug 448 € accurate-monoclonals human
GWB-B0C7EC Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) Mouse 1 vial 579 € genways mouse
GWB-E2D12F antibody to or anti- Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) antibody 1 vial 521 € genways human
GWB-B5A726 antibody to or anti- Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) Human -biotin conjugated antibody 1 vial 602 € genways human
GWB-8AF7B9 antibody to or anti-Human Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF) antibody 1 vial 667 € genways human
E-EL-C0217 Canine GM-CSF (Granulocyte Macrophage Colony Stimulating Factor) ELISA Kit 96T 624 € elabsciences human
E-EL-Ch0665 Chicken GM-CSF Ab (Anti-Granulocyte Macrophage Colony Stimulating Factor Antibody) ELISA Kit 96T 568 € elabsciences chicken
AE41859GO-48 ELISA test for Goat Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF) 1x plate of 48 wells 402 € abebio human
AE63078HU-48 ELISA test for Human Anti-Granulocyte-Macrophage Colony Stimulating Factor antibody (GM-CSF) Ab 1x plate of 48 wells 352 € abebio human
AE60966RB-48 ELISA test for Rabbit Granulocyte Colony Stimulating Factor (G-CSF) 1x plate of 48 wells 373 € abebio human
AE41859GO Goat Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE41859GO-96 Goat Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF) ELISA Kit 1x plate of 96 wells 671 € abebio human
GWB-1A0984 Granulocyte Colony-Stimulating Factor (G-CSF) 1 x 1 vial 579 € genways human