| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Macrophage colony-stimulating factor 1 is produced by our Mammalian expression system and the target gene encoding Lys33-Glu262 is expressed |
| Molecular Weight: |
26 kD |
| UniProt number: |
P07141 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLEVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CSF1, M-CSF |
| Short name: |
CSF1, Recombinant Mouse M-CSF |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
colony stimulating factor 1 (macrophage), recombinant Mouse M-CSF |
| Alternative technique: |
rec |
| Alternative to gene target: |
CSF-1 and MCSF, CSF1 and IDBG-100920 and ENSG00000184371 and 1435, CSF1 and IDBG-635251 and ENSBTAG00000000283 and 281094, Csf1 and IDBG-185535 and ENSMUSG00000014599 and 12977, Extracellular, protein homodimerization activity, this GO :0001503 and ossification and biological process this GO :0001954 and positive regulation of cell-matrix adhesion and biological process this GO :0002158 and osteoclast proliferation and biological process this GO :0003006 and developmental process involved in reproduction and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005157 and macrophage colony-stimulating factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010743 and regulation of macrophage derived foam cell differentiation and biological process this GO :0010744 and positive regulation of macrophage derived foam cell differentiation and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030097 and hemopoiesis and biological process this GO :0030154 and cell differentiation and biological process this GO :0030225 and macrophage differentiation and biological process this GO :0030278 and regulation of ossification and biological process this GO :0030316 and osteoclast differentiation and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0032270 and positive regulation of cellular protein metabolic process and biological process this GO :0032946 and positive regulation of mononuclear cell proliferation and biological process this GO :0040018 and positive regulation of multicellular organism growth and biological process this GO :0042117 and monocyte activation and biological process this GO :0042476 and odontogenesis and biological process this GO :0042488 and positive regulation of odontogenesis of dentin-containing tooth and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043235 and receptor complex and cellular component this GO :0045087 and innate immune response and biological process this GO :0045651 and positive regulation of macrophage differentiation and biological process this GO :0045657 and positive regulation of monocyte differentiation and biological process this GO :0045672 and positive regulation of osteoclast differentiation and biological process this GO :0045860 and positive regulation of protein kinase activity and biological process this GO :0046579 and positive regulation of Ras protein signal transduction and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0048873 and homeostasis of number of cells within a tissue and biological process this GO :0060444 and branching involved in mammary gland duct morphogenesis and biological process this GO :0060611 and mammary gland fat development and biological process this GO :0060763 and mammary duct terminal end bud growth and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005157 : macrophage colony-stimulating factor receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0042803 : protein homodimerization activity, this GO :0005157 : macrophage colony-stimulating factor receptor binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0042803 : protein homodimerization activity, colony stimulating factor 1 (macrophage) |
| Identity: |
2432 |
| Gene: |
CSF1 |
More about : CSF1 |
| Long gene name: |
colony stimulating factor 1 |
| Synonyms gene name: |
colony stimulating factor 1 (macrophage) |
| Synonyms: |
M-CSF MCSF MGC31930 |
| Synonyms name: |
macrophage colony stimulating factor 1 |
| Locus: |
1p13, 3 |
| Discovery year: |
1986-01-01 |
| GenBank acession: |
BC021117 |
| Entrez gene record: |
1435 |
| Pubmed identfication: |
1540160 |
| RefSeq identity: |
NM_000757 |
| Havana BLAST/BLAT: |
OTTHUMG00000011646 |