Recombinant Mouse Betacellulin, BTC (N-6His)

Contact us
Catalog number: C747
Price: 348 €
Supplier: MBS Polyclonals
Product name: Recombinant Mouse Betacellulin, BTC (N-6His)
Quantity: 0.12 ml
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Betacellulin is produced by our E, coli expression system and the target gene encoding Asp32-Gln118 is expressed with a 6His tag at the N-terminus
Molecular Weight: 12, 2 kD
UniProt number: Q543J8
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMDGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFYLQQDRGQ
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: BTC (N-6His), Betacellulin
Short name: BTC (N-6His), Recombinant Mouse Betacellulin
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: betacellulin (N-6His), recombinant Mouse Betacellulin
Alternative technique: rec
Alternative to gene target: BTC and IDBG-24477 and ENSG00000174808 and 685, BTC and IDBG-643041 and ENSBTAG00000004237 and 280737, Btc and IDBG-394187 and ENSMUSG00000082361 and 12223, Extracellular, growth factor activity, this GO :0005154 and epidermal growth factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0035810 and positive regulation of urine volume and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045597 and positive regulation of cell differentiation and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048146 and positive regulation of fibroblast proliferation and biological process this GO :0051781 and positive regulation of cell division and biological process, this GO :0005154 : epidermal growth factor receptor binding, this GO :0005154 : epidermal growth factor receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, betacellulin
Identity: 1121
Gene: BTC | More about : BTC
Long gene name: betacellulin
Locus: 4q13, 3
Discovery year: 1994-07-21
GenBank acession: S55606
Entrez gene record: 685
Pubmed identfication: 8439318 11522793
Havana BLAST/BLAT: OTTHUMG00000130107

Related Products :

C747 Recombinant Mouse Betacellulin, BTC (N-6His) 1 mg 2283 € novo mouse
abx574631 Anti-Mouse Betacellulin (bTC) ELISA Kit 96 tests 673 € abbex mouse
DL-bTC-Mu Mouse Betacellulin bTC ELISA Kit 96T 788 € DL elisas mouse
GENTAUR-58bdc4b1b7cfe Anti- Betacellulin (bTC) Antibody 50ug 326 € MBS Polyclonals human
GENTAUR-58bdc4b21cbfd Anti- Betacellulin (bTC) Antibody 100ug 404 € MBS Polyclonals human
GENTAUR-58bdc7df8b81b Anti- Betacellulin (bTC) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdca4c66cfa Anti- Betacellulin (bTC) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdca4cd1949 Anti- Betacellulin (bTC) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdcddc66cee Anti- Betacellulin (bTC) Antibody 100ug 437 € MBS Polyclonals human
GENTAUR-58bdd479a5156 Anti- Betacellulin (bTC) Antibody 100ug 464 € MBS Polyclonals human
GENTAUR-58bdd7aa6fc60 Anti- Betacellulin (bTC) Antibody 100ug 520 € MBS Polyclonals human
abx574267 Anti-Chicken Betacellulin (bTC) ELISA Kit 96 tests 775 € abbex chicken
abx575529 Anti-Cow Betacellulin (bTC) ELISA Kit 96 tests 833 € abbex cow
abx570040 Anti-Human Betacellulin (bTC) ELISA Kit inquire 50 € abbex human
abx576495 Anti-Rat Betacellulin (bTC) ELISA Kit inquire 50 € abbex rat
EKU02697 Betacellulin (bTC) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
EKU02698 Betacellulin (bTC) ELISA kit 1 plate of 96 wells 650 € Biomatik ELISA kits human
DL-bTC-b Bovine Betacellulin bTC ELISA Kit 96T 962 € DL elisas bovine
DL-bTC-Ch Chicken Betacellulin bTC ELISA Kit 96T 904 € DL elisas chicken
DL-bTC-Hu Human Betacellulin bTC ELISA Kit 96T 846 € DL elisas human
DL-bTC-Ra Rat Betacellulin bTC ELISA Kit 96T 904 € DL elisas rat
GWB-P0788H BTC, 32-111aa, Recombinant Protein bulk Ask price € genways bulk human
ZR-40-192 Betacellulin Recombinant Protein 0.005 mg 256 € Zyagen human
ZR-40-578 Betacellulin Recombinant Protein 0.005 mg 256 € Zyagen human
GWB-BIG048 Recombinant Human Betacellulin bulk Ask price € genways bulk human
GWB-BIG166 Recombinant Murine Betacellulin bulk Ask price € genways bulk human
103-M308 Anti-Mouse Betacellulin 100ug 336 € Reliatech antibodies mouse
CEK1374 anti-Mouse Betacellulin ELISA Kit Antibody 96 Tests 703 € acr mouse
A01B0102 anti-BTC Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58be022aec4c7 Anti- BTC Antibody 0.12 ml 348 € MBS Polyclonals human