Recombinant Mouse Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-6His)

Contact us
Catalog number: C694
Price: 553 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Mouse Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Tumor Necrosis Factor Receptor II is produced by our Mammalian expression system and the target gene encoding Val23-Gly258 is expressed with a 6His tag at the C-terminus
Molecular Weight: 26, 4 kD
UniProt number: Q545P4
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGGVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CD120b (C-6His), TNFRSF1B, Tumor Necrosis Factor Receptor II
Short name: CD120b (C-6His), TNFRSF1B, Recombinant Mouse Tumor Necrosis Factor Receptor II
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CD120b (C-6His), member 1B, tumor necrosis factor receptor superfamily, recombinant Mouse Tumor Necrosis Factor Receptor II
Alternative technique: rec
Alternative to gene target: CD120b and p75 and p75TNFR and TBPII and TNF-R-II and TNF-R75 and TNFBR and TNFR1B and TNFR2 and TNFR80, TNFRSF1B and IDBG-632369 and ENSBTAG00000024928 and 338033, TNFRSF1B and IDBG-90091 and ENSG00000028137 and 7133, Tnfrsf1b and IDBG-203277 and ENSMUSG00000028599 and 21938, member 1B, nuclei, this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005634 and nucleus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007568 and aging and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030424 and axon and cellular component this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0032496 and response to lipopolysaccharide and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043196 and varicosity and cellular component this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0050779 and RNA destabilization and biological process this GO :0051044 and positive regulation of membrane protein ectodomain proteolysis and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071363 and cellular response to growth factor stimulus and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process, this GO :0005031 : tumor necrosis factor-activated receptor activity, this GO :0005031 : tumor necrosis factor-activated receptor activity and also this GO :0005515 : protein binding and also this GO :0031625 : ubiquitin protein ligase binding, this GO :0005515 : protein binding, this GO :0031625 : ubiquitin protein ligase binding, ubiquitin protein ligase binding, tumor necrosis factor receptor superfamily
Identity: 11917
Gene: TNFRSF1B | More about : TNFRSF1B
Long gene name: TNF receptor superfamily member 1B
Synonyms gene: TNFR2
Synonyms gene name: member 1B , tumor necrosis factor receptor superfamily
Synonyms: TNFBR TNFR80 TNF-R75 TNF-R-II p75 CD120b
Locus: 1p36, 22
Discovery year: 1991-01-15
GenBank acession: M32315
Entrez gene record: 7133
Pubmed identfication: 2158863 8702885
RefSeq identity: NM_001066
Classification: CD molecules Tumor necrosis factor receptor superfamily
Havana BLAST/BLAT: OTTHUMG00000001829

Related Products :

C694 Recombinant Mouse Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-6His) 500 µg 1613 € novo mouse
CI39 Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-6His) 500 µg 1613 € novo human
C782 Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (Lys288-Ser461, C-6His) 10 µg 156 € novo human
CP11 Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-Fc) 500 µg 1613 € novo human
MBS617120 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) 100ug 868 € MBS Polyclonals_1 human
MBS624468 Tumor Necrosis Factor Receptor 2, p75/p80 (TNFR 2, Tnfr2, Tnfr-2, TNF-R2, Tumor Necrosis Factor Receptor Type II, TNFRII, TNFR-II, TNF-RII, TNF-R-II, CD120b, p75, p80 TNF alpha Receptor, TNF-R75, TNFR80, TNFalpha-R2, TNF-alphaR2, Tumor Necrosis Factor bet 1 mililiter 1061 € MBS Polyclonals_1 human
MBS621645 DR6 (Death Receptor 6, BM018, MGC31965, TNFR Related Death Receptor 6, Tumor Necrosis Factor Receptor Superfamily Member 21, Tumor Necrosis Factor Receptor Superfamily Member 21 Precursor, TNFRSF21) Antibody 100ug 564 € MBS Polyclonals_1 human
GWB-19048A Tumor Necrosis Factor Receptor Superfamily, Member 1B (TNFRSF1B) Rabbit antibody to or anti-Mouse Polyclonal (C- terminus) antibody 1 x 1 vial 648 € genways mouse
RP-1559M Recombinant Mouse TNFR2 / CD120b / TNFRSF1B Protein (Fc Tag) 50μg 659 € adv mouse
RP-1558M Recombinant Mouse TNFR2 / CD120b / TNFRSF1B Protein (His Tag) 50μg 624 € adv mouse
MBS620184 TNF Receptor, Extracellular Domain p55 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) Antibody 1000ug 685 € MBS Polyclonals_1 human
MBS619623 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, TNFR1, TNF-R1, TNF-R, Tumor Necrosis Factor Receptor Type I, TNFR-I, TNF-RI, TNF-R-I, CD120a, FPF, MGC19588, p55, p55-R, p60, TBP1, TNFR55, TNF-R55, TNFR60, Tumor Necrosis Factor alpha Receptor, TNFAR, Tu Antibody 100ug 652 € MBS Polyclonals_1 human
GENTAUR-58bdcf599fa2c Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1B (TNFRSF1B) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd09e90269 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1B (TNFRSF1B) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdd09ef0387 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1B (TNFRSF1B) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdd69f78928 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1B (TNFRSF1B) Antibody 100ug 553 € MBS Polyclonals human
DL-TNFRSF1B-Hu Human Tumor Necrosis Factor Receptor Superfamily, Member 1B TNFRSF1B ELISA Kit 96T 568 € DL elisas human
DL-TNFRSF1B-Ra Rat Tumor Necrosis Factor Receptor Superfamily, Member 1B TNFRSF1B ELISA Kit 96T 846 € DL elisas rat
EKU07975 Tumor Necrosis Factor Receptor Superfamily, Member 1B (TNFRSF1B) ELISA kit 1 plate of 96 wells 544 € Biomatik ELISA kits human
EKU07976 Tumor Necrosis Factor Receptor Superfamily, Member 1B (TNFRSF1B) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
RP-1166RC Recombinant Cynomolgus TNFR2 / CD120b / TNFRSF1B Protein (Fc Tag) 5μg 346 € adv human
RP-1167RC Recombinant Cynomolgus TNFR2 / CD120b / TNFRSF1B Protein (His Tag) 20μg 572 € adv human
RP-1527H Recombinant Human TNFR2 / CD120b / TNFRSF1B Protein (aa 1-268, 196 Met/Arg, His Tag) 50μg 624 € adv human
RP-1529H Recombinant Human TNFR2 / CD120b / TNFRSF1B Protein (His & Fc Tag) 50μg 624 € adv human
RP-1528H Recombinant Human TNFR2 / CD120b / TNFRSF1B Protein (His Tag) 50μg 624 € adv human
MBS611896 Tumor Necrosis Factor Receptor 2, p75/p80 (TNFR2, CD120b) 100ug 868 € MBS Polyclonals_1 human
MBS610542 Tumor Necrosis Factor Receptor 2, p75/p80 (TNFR2, CD120b) Antibody 100ug 868 € MBS Polyclonals_1 human
CS43 Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 5, CD40(C-6His) 10 µg 146 € novo mouse
C689 Recombinant Human Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a (N-6His) 10 µg 156 € novo human
MBS621537 BAFF Receptor (BAFFR, BAFF-R, B Cell-Activating Factor Receptor, BLyS Receptor 3, BR3, CD268, CD268 Antigen, MGC138235, Tumor Necrosis Factor Receptor Superfamily Member 13C, TNFRSF13C) Antibody 100ug 553 € MBS Polyclonals_1 human