Recombinant Mouse Trefoil Factor 3, TFF3 (C-6His)

Contact us
Catalog number: C661
Price: 603 €
Supplier: MBS Polyclonals
Product name: Recombinant Mouse Trefoil Factor 3, TFF3 (C-6His)
Quantity: 100ug
Other quantities: 10 µg 141€ 50 µg 278€ 500 µg 1471€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Trefoil Factor 3 is produced by our Mammalian expression system and the target gene encoding Ala23-Phe81 is expressed with a 6His at the C-terminus
Molecular Weight: 3 kD, 7
UniProt number: Q62395
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ADYVGLSPSQCMVPANVRVDCGYPSVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTFHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: TFF3 (C-6His), Trefoil Factor 3
Short name: TFF3 (C-6His), Recombinant Mouse Trefoil Factor 3
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: TFF3 (C-6His), recombinant Mouse Trefoil Factor 3
Alternative technique: rec
Identity: 11757
Gene: TFF3 | More about : TFF3
Long gene name: trefoil factor 3
Synonyms gene name: trefoil factor 3 (intestinal)
Synonyms: HITF ITF
Locus: 21q22, 3
Discovery year: 1995-11-22
GenBank acession: AF432265
Entrez gene record: 7033
Pubmed identfication: 7718582 9043862
RefSeq identity: NM_003226
Havana BLAST/BLAT: OTTHUMG00000086798

Related Products :

C661 Recombinant Mouse Trefoil Factor 3, TFF3 (C-6His) 500 µg 1471 € novo mouse
GENTAUR-58bde6a2c1525 Mouse Monoclonal [clone 3D9] (IgG1,k) to Human TFF3 / Trefoil Factor 3 Antibody 50ug 663 € MBS mono human
DL-TFF3-Mu Mouse Trefoil Factor 3, Intestinal TFF3 ELISA Kit 96T 904 € DL elisas mouse
TFF31-P Mouse Trefoil factor 3 (TFF3) Control/blocking peptide #1 100 μg 188 € adi mouse
TFF31-A Rabbit Anti-Mouse Trefoil factor 3 (TFF3) IgG # 1 (aff pure) 100 μg 565 € adi mouse
abx574327 Anti-Rat Trefoil Factor 3, Intestinal (TFF3) ELISA Kit inquire 50 € abbex rat
GENTAUR-58bdc1a37cb36 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc1a405256 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc48b67da7 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc6434c525 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc643a7c39 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 50ug 409 € MBS Polyclonals human
GENTAUR-58bdc72db3e40 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc75e08726 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 608 € MBS Polyclonals human
GENTAUR-58bdcbc124f75 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 50ug 409 € MBS Polyclonals human
GENTAUR-58bdcbc18eb65 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdccaf303ef Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 586 € MBS Polyclonals human
GENTAUR-58bdcd88e3fe7 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdcd89ae3ff Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdcd8b9688c Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcd8c1cfc5 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdce39db905 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdcf6c7b44e Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdcf6ce9429 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd2cb87c99 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 586 € MBS Polyclonals human
GENTAUR-58bdd43b287c9 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdd69636604 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdd6f5982da Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd90cf3178 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 625 € MBS Polyclonals human
GENTAUR-58bddb1f478d2 Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 625 € MBS Polyclonals human
GENTAUR-58bddcc56c23d Anti- Trefoil Factor 3, Intestinal (TFF3) Antibody 100ug 603 € MBS Polyclonals human