Recombinant Human Acrosomal Protein SP-10, ACRV1 (C-6His)

Contact us
Catalog number: C421
Price: 587 €
Supplier: acr
Product name: Recombinant Human Acrosomal Protein SP-10, ACRV1 (C-6His)
Quantity: 0,4 ml
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Acrosomal Protein SP-10 is produced by our Mammalian expression system and the target gene encoding Gln22-Ile265 is expressed with a 6His tag at the C-terminus
Molecular Weight: 26, 9 kD
UniProt number: P26436
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKIVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ACRV1 (C-6His), Acrosomal Protein SP-10
Short name: ACRV1 (C-6His), Recombinant Acrosomal Protein SP-10
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ACRV1 (C-6His), sapiens Acrosomal Protein SP-10, recombinant H
Alternative technique: rec
Identity: 127
Gene: ACRV1 | More about : ACRV1
Long gene name: acrosomal vesicle protein 1
Synonyms: SPACA2 SP-10 D11S4365
Synonyms name: sperm protein 10
Locus: 11q24, 2
Discovery year: 1991-06-07
GenBank acession: AK223335
Entrez gene record: 56
Pubmed identfication: 1693291 8288254
RefSeq identity: NM_001612
Havana BLAST/BLAT: OTTHUMG00000165854

Related Products :

C421 Recombinant Human Acrosomal Protein SP-10, ACRV1 (C-6His) 50 µg 369 € novo human
RP-1444H Recombinant Human SP-10 / ACRV1 Protein (His Tag) 50μg 659 € adv human
LV067458 ACRV1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV067459 ACRV1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV067460 ACRV1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV067461 ACRV1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV067463 ACRV1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV067462 ACRV1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
YM8017 Intra-Acrosomal Sperm Protein, Clone: Hs-14, Mouse Monoclonal antibody-Human 1000ul 760 € accurate-monoclonals human
YM8016 Intra-Acrosomal Sperm Protein, Clone: Hs-8, Mouse Monoclonal antibody-Human, Boar 1000ul 1579 € accurate-monoclonals human
GWB-MT143H ACRV1 antibody 1 vial 521 € genways human
GWB-1FCBFC ACRV1 Over-expression Lysate reagent 1 x 1 vial 463 € genways human
GWB-36D754 ACRV1 Over-expression Lysate reagent 1 x 1 vial 463 € genways human
GWB-A7EFA0 ACRV1 Over-expression Lysate reagent 1 vial 463 € genways human
GWB-D18C64 ACRV1 Over-expression Lysate reagent 1 vial 562 € genways human
GENTAUR-58be0c6c3b900 Anti- ACRV1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0c6ca117c Anti- ACRV1 Antibody 0.12 ml 348 € MBS Polyclonals human
SM3096P anti-ACRV1 Antibody 0,1 mg 398 € acr human
abx906574 Anti-ACRV1 siRNA 15 nmol 528 € abbex human
abx906575 Anti-ACRV1 siRNA 30 nmol 717 € abbex human
AP22507PU-N anti-Activin receptor type 1 / ACRV1 (147-161) Antibody 50 Вµg 732 € acr human
AP08420PU-N anti-Activin receptor type 1 / ACRV1 (475-509) Antibody 50 Вµg 732 € acr human
AP05119PU-N anti-Activin receptor type 1 / ACRV1 Antibody 0,25 mg 587 € acr human
AP08925PU-N anti-Activin receptor type 1 / ACRV1 Antibody 50 Вµg 732 € acr human
AP13706PU-N anti-Activin receptor type 1 / ACRV1 Antibody 0,4 ml 587 € acr human
AP13708PU-N anti-Activin receptor type 1 / ACRV1 Antibody 0,4 ml 587 € acr human
AP14607PU-N anti-Activin receptor type 1 / ACRV1 Antibody 0,4 ml 587 € acr human
GT41003-100 anti-Activin receptor type 1 / ACRV1 (C-term) Antibody 0,1 mg 659 € acr human
AP30014CP-N anti-Activin receptor type 1 / ACRV1 Control Peptide Antibody 50 Вµg 282 € acr human
AP13707PU-N anti-Activin receptor type 1 / ACRV1 (N-term) Antibody 0,4 ml 587 € acr human