| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human BH3-Interacting Domain Death Agonist is produced by our E, coli expression system and the target gene encoding Met1-Asp195 is expressed |
| Molecular Weight: |
21, 99 kD |
| UniProt number: |
P55957 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
100 mM KCl, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BID, BH3-Interacting Domain Death Agonist |
| Short name: |
BID, Recombinant BH3-Interacting Domain Death Agonist |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
BH3 interacting domain death a this GO nist, sapiens BH3-Interacting Domain Death Agonist, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BID and IDBG-1050 and ENSG00000015475 and 101929618, BID and IDBG-641320 and ENSBTAG00000013988 and 510373, Bid and IDBG-184076 and ENSMUSG00000004446 and 12122, FP497, Plasma membranes, this GO :0001836 and release of cytochrome c from mitochondria and biological process this GO :0005123 and death receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005741 and mitochondrial outer membrane and cellular component this GO :0005829 and cytosol and cellular component this GO :0006626 and protein targeting to mitochondrion and biological process this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0007420 and brain development and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0008637 and apoptotic mitochondrial changes and biological process this GO :0016020 and membrane and cellular component this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0032355 and response to estradiol and biological process this GO :0032459 and regulation of protein oli this GO merization and biological process this GO :0032461 and positive regulation of protein oli this GO merization and biological process this GO :0032464 and positive regulation of protein homooli this GO merization and biological process this GO :0032592 and integral component of mitochondrial membrane and cellular component this GO :0034349 and glial cell apoptotic process and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042770 and signal transduction in response to DNA damage and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0051260 and protein homooli this GO merization and biological process this GO :0051402 and neuron apoptotic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0090150 and establishment of protein localization to membrane and biological process this GO :0090200 and positive regulation of release of cytochrome c from mitochondria and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :0097193 and intrinsic apoptotic signaling pathway and biological process this GO :1900740 and positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway and biological process this GO :1901030 and positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway and biological process this GO :1902108 and regulation of mitochondrial membrane permeability involved in apoptotic process and biological process this GO :2000045 and regulation of G1/S transition of mitotic cell cycle and biological process this GO :2001238 and positive regulation of extrinsic apoptotic signaling pathway and biological process this GO :2001244 and positive regulation of intrinsic apoptotic signaling pathway and biological process, this GO :0005123 : death receptor binding, this GO :0005123 : death receptor binding and also this GO :0005515 : protein binding and also this GO :0031625 : ubiquitin protein ligase binding, this GO :0005515 : protein binding, this GO :0031625 : ubiquitin protein ligase binding, ubiquitin protein ligase binding, 637, 782484, BH3 interacting domain death a this GO nist |
| Identity: |
1050 |
| Gene: |
BID |
More about : BID |
| Long gene name: |
BH3 interacting domain death agonist |
| Locus: |
22q11, 21 |
| Discovery year: |
1998-04-20 |
| GenBank acession: |
AF042083 |
| Entrez gene record: |
637 |
| Pubmed identfication: |
8918887 9721221 |
| RefSeq identity: |
NM_197966 |
| Classification: |
Endogenous ligands BCL2 homology region 3 (BH3) only |
| Havana BLAST/BLAT: |
OTTHUMG00000150087 |