Recombinant Mouse Interleukin-13, IL-13 (Pro22-Phe131)

Contact us
Catalog number: C088
Price: Ask price €
Supplier: genways bulk
Product name: Recombinant Mouse Interleukin-13, IL-13 (Pro22-Phe131)
Quantity: bulk
Other quantities: 1 mg 3145€ 50 µg 496€ 500 µg 2217€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Interleukin-13 is produced by our E, coli expression system and the target gene encoding Pro22-Phe131 is expressed
Molecular Weight: 12, 2 kD
UniProt number: P20109
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: IL-13 (Pro22-Phe131), Interleukin-13
Short name: IL-13 (Pro22-Phe131), Recombinant Mouse Interleukin-13
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: Interleukin-13 (Pro22-Phe131), recombinant Mouse Interleukin-13
Alternative technique: rec
Identity: 5973
Gene: IL13 | More about : IL13
Long gene name: interleukin 13
Synonyms: P600 IL-13 ALRH BHR1 MGC116786 MGC116788 MGC116789
Synonyms name: allergic rhinitis Bronchial hyperresponsiveness-1 (bronchial asthma)
Locus: 5q31, 1
Discovery year: 1993-04-07
GenBank acession: U31120
Entrez gene record: 3596
RefSeq identity: NM_002188
Classification: Interleukins
Havana BLAST/BLAT: OTTHUMG00000059723

Related Products :

C088 Recombinant Mouse Interleukin-13, IL-13 (Pro22-Phe131) 1 mg 3145 € novo mouse
CD56 Recombinant Mouse Interleukin-13, IL-13 (Pro22-Phe131,C-6His) 500 µg 2217 € novo mouse
CH18 Recombinant Mouse Interleukin-13, IL-13 (Ser26-Phe131) 1 mg 2486 € novo mouse
OBT0092G Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; frozen, ELISA/WB/flow 0.5 mg Ask price € accurate-monoclonals mouse
OBT0092Z Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; frozen, flow/ELISA/WB/Functional Assays: Azide Free 1 mg Ask price € accurate-monoclonals mouse
OBT0092 Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; frozen, IH/ELISA/WB/IA 0.25 mg Ask price € accurate-monoclonals mouse
OBT0092R Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, RPE 500ul Ask price € accurate-monoclonals mouse
OBT0088G Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse 0.5 mg Ask price € accurate-monoclonals mouse
OBT0088Z Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Azide Free 1 mg Ask price € accurate-monoclonals mouse
OBT0088B Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Biotin 200ug Ask price € accurate-monoclonals mouse
OBT0088BB Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Biotin 0.5 mg Ask price € accurate-monoclonals mouse
OBT0088F Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, FITC 0.1 mg Ask price € accurate-monoclonals mouse
OBT0088 Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; ELISA/WB/IA 0.25 mg Ask price € accurate-monoclonals mouse
OBT0088R Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, RPE 500ul Ask price € accurate-monoclonals mouse
OBT0090 Interleukin 5 (IL-5), natural & recombinant, Clone: TRFK5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; ELISA/WB/IA 0.5 mg Ask price € accurate-monoclonals mouse
OBT0090R Interleukin 5 (IL-5), natural & recombinant, Clone: TRFK5, Rat Mouse Monoclonal antibody-Mouse, RPE 500ul Ask price € accurate-monoclonals mouse
YM5036 Interleukin 6 (IL-6), Bioactivity inhibitor, native & recombinant, Clone: F5, Rat Mouse Monoclonal antibody-Mouse 3 ml Ask price € accurate-monoclonals mouse
YM5017 Interleukin 6 (IL-6), natural & recombinant, Clone: MP5-32C11, Mouse Monoclonal antibody-Mouse (NO X w/Human or Rat); IA/IP/Inhibition 0.1mg 1004 € accurate-monoclonals rat
MBS624348 IL6ST, phosphorylated (Tyr905) (Interleukin-6 Receptor Subunit beta, IL-6R-beta, Interleukin-6 Signal Transducer, Membrane Glycoprotein 130, gp130, CDw130, Oncostatin-M Receptor Subunit alpha, CD130, IL-6 Receptor Subunit beta, IL-6R Subunit beta) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS621212 Interleukin 1 Receptor AcP, C2 (IL1RacP, IL-1 Receptor Accessory Protein, IL-1RAP, FLJ37788, IL1R3, Interleukin 1 Accessory Protein) Antibody 100ug 857 € MBS Polyclonals_1 human
MBS611936 Interleukin 18BP (IL-18BP, IL18BPa, Interleukin 18 Binding Protein, Tadekinig-alfa, interferon-gamma inducing factor, IGIF) Antibody 100ug 597 € MBS Polyclonals_1 human
MBS612345 Interleukin 18BP (IL-18BP, IL18BPa, Interleukin 18 Binding Protein, Tadekinig-alfa, interferon-gamma inducing factor, IGIF) Antibody 50ug 382 € MBS Polyclonals_1 human
GWB-2163DF INTERLEUKIN 6 CROSS REACTIVE WITH RAT INTERLEUKIN 6 1 x 1 vial 752 € genways human
MBS622653 IRAK4, CT (interleukin-1 receptor-associated kinase 4, Interleukin-1 receptor-associated kinase 4, IPD1, IRAK-4, NY-REN-64, NY-REN-64 antigen, REN64) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS617327 NFIL3 (E4 Promoter Binding Protein 4, E4BP4, E4BP4 Protein, Interleukin 3 Binding Protein 1, IL3BP1, Interleukin 3 Promoter Transcriptional Activator, NFIL3A, Nuclear Factor Interleukin 3 Regulated, Transcriptional Activator NF-IL3A) Antibody 100ug 591 € MBS Polyclonals_1 human
MAS612p Interleukin 2 (IL-2), natural & recombinant, Clone: GE14, Mouse Monoclonal antibody-Human; frozen, IH/ELISA/IA 0.5 mg Ask price € accurate-monoclonals human
MAS614p Interleukin 4 (IL-4), natural & recombinant, Clone: IL-4-5, Mouse Monoclonal antibody-Human, Inhibits activity; frozen, IH/ELISA/IA 0.2mg Ask price € accurate-monoclonals human
GWB-P0138H Mouse Interleukin-2, 21-169 aa, Recombinant Protein bulk Ask price € genways bulk mouse
GWB-9BC459 Recombinant Mouse Interleukin-1 beta His Tag bulk Ask price € genways bulk mouse
GWB-4B6009 Recombinant Mouse Interleukin-1 Receptor Antagonist bulk Ask price € genways bulk mouse