Recombinant Human Stem Cell Factor, SCF, c-Kit Ligand

Contact us
Catalog number: C034
Price: 544 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Human Stem Cell Factor, SCF, c-Kit Ligand
Quantity: 1 plate of 96 wells
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1298€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Receptor agonists are often tested for drug development, FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling
Molecular Weight: 18, 4 kD
UniProt number: P21583
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: SCF, c-Kit Ligand, Stem Factor
Short name: SCF, c-Kit Ligand, Recombinant Stem Cell Factor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: SCF, c-reagent Ligand, sapiens progenitor cellular Factor, recombinant H
Alternative technique: rec
Identity: 6343
Gene: KITLG | More about : KITLG
Long gene name: KIT ligand
Synonyms gene: MGF
Synonyms: SCF SF Kitl KL-1 FPH2
Synonyms name: mast cell growth factor stem cell factor steel factor familial progressive hyperpigmentation 2
Locus: 12q21, 32
Discovery year: 1991-06-04
GenBank acession: M59964
Entrez gene record: 4254
Pubmed identfication: 2208279 1707188 19375057
RefSeq identity: NM_003994
Havana BLAST/BLAT: OTTHUMG00000169888

Related Products :

BMAhKL12 Stem Cell Factor (SCF), c-Kit Ligand, Mast Cell Growth Factor, Steel Factor, Clone: hKL 12, Mouse Monoclonal antibody-Human; frozen/paraffin, IH/ELISA/WB 0.2mg 1397 € accurate-monoclonals human
C034 Recombinant Human Stem Cell Factor, SCF, c-Kit Ligand 10 µg 202 € novo human
CD53 Recombinant Human Stem Cell Factor, SCF, c-Kit Ligand (C-6His) 10 µg 146 € novo human
C775 Recombinant Mouse Stem Cell Factor, SCF, c-Kit Ligand 50 µg 496 € novo mouse
MBS610406 SCF (Stem Cell Factor, CD117 c-kit, Steel Factor, Mast Cell Growth Factor, MGF) 100ug 763 € MBS Polyclonals_1 human
GWB-P0060H SCF (Stem Cell Factor) Human, Recombinant Protein bulk Ask price € genways bulk human
CF96 Recombinant Rat Stem Cell Factor, SCF (C-6His) 10 µg 141 € novo rat
GWB-C586FC Stem Cell Factor (SCF) recombinant 1 vial 579 € genways human
abx575478 Anti-Human Stem Cell Factor (SCF) ELISA Kit 96 tests 543 € abbex human
DL-SCF-Hu Human Stem Cell Factor SCF ELISA Kit 96T 672 € DL elisas human
abx575535 Anti-Chicken Stem Cell Factor (SCF) ELISA Kit inquire 50 € abbex chicken
abx576359 Anti-Cow Stem Cell Factor (SCF) ELISA Kit 96 tests 833 € abbex cow
abx574741 Anti-Dog Stem Cell Factor (SCF) ELISA Kit 96 tests 804 € abbex dog
abx576360 Anti-Equine Stem Cell Factor (SCF) ELISA Kit inquire 50 € abbex human
abx575794 Anti-Goat Stem Cell Factor (SCF) ELISA Kit inquire 50 € abbex human
abx574577 Anti-Mouse Stem Cell Factor (SCF) ELISA Kit 96 tests 528 € abbex mouse
abx574742 Anti-Pig Stem Cell Factor (SCF) ELISA Kit inquire 50 € abbex pig
abx574578 Anti-Rat Stem Cell Factor (SCF) ELISA Kit inquire 50 € abbex rat
DL-SCF-b Bovine Stem Cell Factor SCF ELISA Kit 96T 962 € DL elisas bovine
E-EL-C0061 Canine SCF (Stem Cell Factor) ELISA Kit 96T 624 € elabsciences human
DL-SCF-c Canine Stem Cell Factor SCF ELISA Kit 96T 921 € DL elisas human
DL-SCF-Ch Chicken Stem Cell Factor SCF ELISA Kit 96T 904 € DL elisas chicken
DL-SCF-Eq Equine Stem Cell Factor SCF ELISA Kit 96T 974 € DL elisas human
DL-SCF-g Goat Stem Cell Factor SCF ELISA Kit 96T 974 € DL elisas human
DL-SCF-Mu Mouse Stem Cell Factor SCF ELISA Kit 96T 672 € DL elisas mouse
DL-SCF-p Porcine Stem Cell Factor SCF ELISA Kit 96T 962 € DL elisas porcine
DL-SCF-Ra Rat Stem Cell Factor SCF ELISA Kit 96T 904 € DL elisas rat
EKU07461 Stem Cell Factor (SCF) ELISA kit 1 plate of 96 wells 883 € Biomatik ELISA kits human
EKU07462 Stem Cell Factor (SCF) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
EKU07463 Stem Cell Factor (SCF) ELISA kit 1 plate of 96 wells 544 € Biomatik ELISA kits human