Recombinant Mouse Noggin, NOG (C-6His)

Contact us
Catalog number: C028
Price: 652 €
Supplier: MBS Polyclonals
Product name: Recombinant Mouse Noggin, NOG (C-6His)
Quantity: 100ug
Other quantities: 1 mg 1877€ 10 µg 141€ 50 µg 303€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Noggin is produced by our Mammalian expression system and the target gene encoding Gln28-Cys232 is expressed with a 6His tag at the C-terminus
Molecular Weight: 23, 9 kD
UniProt number: P97466
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSCHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: NOG (C-6His), Noggin
Short name: NOG (C-6His), Recombinant Mouse Noggin
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: noggin (C-6His), recombinant Mouse Noggin
Alternative technique: rec
Alternative to gene target: Extracellular, NOG and IDBG-60160 and ENSG00000183691 and 9241, NOG and IDBG-647068 and ENSBTAG00000040282 and 538769, Nog and IDBG-208239 and ENSMUSG00000048616 and 18121, SYM1 and SYNS1, protein homodimerization activity, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0001501 and skeletal system development and biological process this GO :0001649 and osteoblast differentiation and biological process this GO :0001655 and urogenital system development and biological process this GO :0001657 and ureteric bud development and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001706 and endoderm formation and biological process this GO :0001707 and mesoderm formation and biological process this GO :0001837 and epithelial to mesenchymal transition and biological process this GO :0001839 and neural plate morphogenesis and biological process this GO :0001843 and neural tube closure and biological process this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0007389 and pattern specification process and biological process this GO :0007399 and nervous system development and biological process this GO :0007411 and axon guidance and biological process this GO :0007417 and central nervous system development and biological process this GO :0007420 and brain development and biological process this GO :0008045 and motor neuron axon guidance and biological process this GO :0009953 and dorsal/ventral pattern formation and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0019955 and cytokine binding and molecular function this GO :0021510 and spinal cord development and biological process this GO :0021533 and cell differentiation in hindbrain and biological process this GO :0021915 and neural tube development and biological process this GO :0021983 and pituitary gland development and biological process this GO :0030336 and negative regulation of cell migration and biological process this GO :0030509 and BMP signaling pathway and biological process this GO :0030510 and regulation of BMP signaling pathway and biological process this GO :0030514 and negative regulation of BMP signaling pathway and biological process this GO :0035019 and somatic stem cell maintenance and biological process this GO :0042060 and wound healing and biological process this GO :0042474 and middle ear morphogenesis and biological process this GO :0042733 and embryonic digit morphogenesis and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0045596 and negative regulation of cell differentiation and biological process this GO :0045668 and negative regulation of osteoblast differentiation and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048318 and axial mesoderm development and biological process this GO :0048570 and notochord morphogenesis and biological process this GO :0048646 and anatomical structure formation involved in morphogenesis and biological process this GO :0048706 and embryonic skeletal system development and biological process this GO :0048712 and negative regulation of astrocyte differentiation and biological process this GO :0048762 and mesenchymal cell differentiation and biological process this GO :0050679 and positive regulation of epithelial cell proliferation and biological process this GO :0051216 and cartilage development and biological process this GO :0060044 and negative regulation of cardiac muscle cell proliferation and biological process this GO :0060173 and limb development and biological process this GO :0060272 and embryonic skeletal joint morphogenesis and biological process this GO :0060302 and negative regulation of cytokine activity and biological process this GO :0060325 and face morphogenesis and biological process this GO :0060394 and negative regulation of pathway-restricted SMAD protein phosphorylation and biological process this GO :0060425 and lung morphogenesis and biological process this GO :0060513 and prostatic bud formation and biological process this GO :0060676 and ureteric bud formation and biological process this GO :0060825 and fibroblast growth factor receptor signaling pathway involved in neural plate anterior/posterior pattern formation and biological process this GO :0061037 and negative regulation of cartilage development and biological process this GO :0061053 and somite development and biological process this GO :0071773 and cellular response to BMP stimulus and biological process this GO :0090090 and negative regulation of canonical Wnt signaling pathway and biological process this GO :0090190 and positive regulation of branching involved in ureteric bud morphogenesis and biological process this GO :0090193 and positive regulation of glomerulus development and biological process this GO :2000313 and regulation of fibroblast growth factor receptor signaling pathway involved in neural plate anterior/posterior pattern formation and biological process this GO :2001234 and negative regulation of apoptotic signaling pathway and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0019955 : cytokine binding and also this GO :0042803 : protein homodimerization activity, this GO :0019955 : cytokine binding, this GO :0042803 : protein homodimerization activity, noggin
Identity: 7866
Gene: NOG | More about : NOG
Long gene name: noggin
Synonyms gene: SYNS1 SYM1
Synonyms gene name: synostoses (multiple) syndrome 1 symphalangism 1 (proximal)
Locus: 17q22
Discovery year: 1999-03-24
GenBank acession: U31202
Entrez gene record: 9241
Pubmed identfication: 7666191 10080184 11545688
RefSeq identity: NM_005450
Havana BLAST/BLAT: OTTHUMG00000151770

Related Products :

C028 Recombinant Mouse Noggin, NOG (C-6His) 10 µg 141 € novo mouse
C018 Recombinant Human Noggin, NOG (N-8His-Flag) 10 µg 156 € novo human
RP-1132H Recombinant Human Noggin / NOG Protein (Fc Tag) 50μg 572 € adv human
RP-1131H Recombinant Human Noggin / NOG Protein (His Tag) 20μg 456 € adv human
abx570734 Anti-Mouse Noggin (NOG) ELISA Kit 96 tests 804 € abbex mouse
DL-NOG-Mu Mouse Noggin NOG ELISA Kit 96T 921 € DL elisas mouse
abx570462 Anti-Human Noggin (NOG) ELISA Kit inquire 50 € abbex human
GENTAUR-58bdc58305a8e Anti- Noggin (NOG) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc583661c6 Anti- Noggin (NOG) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc74b20ad1 Anti- Noggin (NOG) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdc74b927b7 Anti- Noggin (NOG) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdc74ebce42 Anti- Noggin (NOG) Antibody 100ug 586 € MBS Polyclonals human
GENTAUR-58bdc7e7e0ecb Anti- Noggin (NOG) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdc7e856d24 Anti- Noggin (NOG) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdca84e23ba Anti- Noggin (NOG) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdcbdeb202c Anti- Noggin (NOG) Antibody 100ug 608 € MBS Polyclonals human
GENTAUR-58bdcc7415ace Anti- Noggin (NOG) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdcc74b2019 Anti- Noggin (NOG) Antibody 50ug 431 € MBS Polyclonals human
GENTAUR-58bdcd5a36719 Anti- Noggin (NOG) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdcd5aac0f0 Anti- Noggin (NOG) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdcd632a603 Anti- Noggin (NOG) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdcd639ccc8 Anti- Noggin (NOG) Antibody 50ug 409 € MBS Polyclonals human
GENTAUR-58bdcfe54bbfb Anti- Noggin (NOG) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd1462e7e6 Anti- Noggin (NOG) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd14687f2d Anti- Noggin (NOG) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdd204ac3fc Anti- Noggin (NOG) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd2a4d6fd5 Anti- Noggin (NOG) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd2ccb212b Anti- Noggin (NOG) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd5a66ad38 Anti- Noggin (NOG) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bdd67b7f9b1 Anti- Noggin (NOG) Antibody 100ug 652 € MBS Polyclonals human