Recombinant Human Retinol-binding protein 1, RBP1

Contact us
Catalog number: CP73
Price: 562 €
Supplier: genways
Product name: Recombinant Human Retinol-binding protein 1, RBP1
Quantity: 1 vial
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Retinol-binding Protein 1 is produced by our E, coli expression system and the target gene encoding Pro2-Gln135 is expressed
Molecular Weight: 15, 7 kD
UniProt number: P09455
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: PVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: RBP1, Retinol-binding protein 1
Short name: RBP1, Recombinant Retinol-binding protein 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: RBP1, sapiens Retinol-binding protein 1, recombinant H
Alternative technique: rec
Identity: 9885
Gene: ARID4A | More about : ARID4A
Long gene name: AT-rich interaction domain 4A
Synonyms gene: RBBP1
Synonyms gene name: retinoblastoma-binding protein 1 AT rich interactive domain 4A (RBP1-like)
Synonyms: RBP1 RBP-1
Locus: 14q23, 1
Discovery year: 1992-09-17
GenBank acession: S57153
Entrez gene record: 5926
Pubmed identfication: 1857421 8455946
RefSeq identity: NM_023001
Classification: AT-rich interaction domain containing
Havana BLAST/BLAT: OTTHUMG00000140320

Related Products :

CP73 Recombinant Human Retinol-binding protein 1, RBP1 50 µg 496 € novo human
DL-RBP1-Hu Human Retinol Binding Protein 1, Cellular RBP1 ELISA Kit 96T 846 € DL elisas human
GENTAUR-58bdcc18b30e5 Anti- Retinol Binding Protein 1, Cellular (RBP1) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdcc19182c8 Anti- Retinol Binding Protein 1, Cellular (RBP1) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdcffbb69e1 Anti- Retinol Binding Protein 1, Cellular (RBP1) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdcffc3ba32 Anti- Retinol Binding Protein 1, Cellular (RBP1) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd0b702b89 Anti- Retinol Binding Protein 1, Cellular (RBP1) Antibody 100ug 608 € MBS Polyclonals human
GENTAUR-58bdd38ca48d8 Anti- Retinol Binding Protein 1, Cellular (RBP1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd6846100e Anti- Retinol Binding Protein 1, Cellular (RBP1) Antibody 100ug 597 € MBS Polyclonals human
GENTAUR-58bdd9462c9be Anti- Retinol Binding Protein 1, Cellular (RBP1) Antibody 100ug 597 € MBS Polyclonals human
EKU07101 Retinol Binding Protein 1, Cellular (RBP1) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
GWB-P0735G RBP1, 1-197aa, Recombinant Protein bulk Ask price € genways bulk human
GENTAUR-58b83a32c8009 Candida albicans FK506-binding protein 1 (RBP1) 100ug 1431 € MBS Recombinant Proteins human
GENTAUR-58b83a331ec1b Candida albicans FK506-binding protein 1 (RBP1) 1000ug 1431 € MBS Recombinant Proteins human
GENTAUR-58b83a3393174 Candida albicans FK506-binding protein 1 (RBP1) 100ug 1934 € MBS Recombinant Proteins human
GENTAUR-58b83a352b678 Candida albicans FK506-binding protein 1 (RBP1) 1000ug 1934 € MBS Recombinant Proteins human
abx152934 Anti-Human RBP1 ELISA Kit 96 tests 847 € abbex human
abx570744 Anti-Human RBP1 ELISA Kit inquire 50 € abbex human
MBS242417 Goat Polyclonal to Human RBP1 / CRBP Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bde82071974 Mouse Monoclonal [clone 2E1] (IgG2a) to Human RBP1 / CRBP Antibody 0.05 ml 597 € MBS mono human
MBS221954 GOAT ANTI RBP1-LIKE PROTEIN Antibody 100ug 713 € MBS Polyclonals_1 human
abx135947 Anti-RBP1 Antibody 100 µl 398 € abbex human
abx904510 Anti-RBP1 siRNA 15 nmol 528 € abbex human
abx931119 Anti-RBP1 siRNA inquire 50 € abbex human
abx931120 Anti-RBP1 siRNA 15 nmol 528 € abbex human
MBS420224 Goat anti-RBP1 Antibody 100ug 370 € MBS Polyclonals_1 human
GENTAUR-58be3721cced5 RBP1 antibody 100ul 630 € MBS mono human
GENTAUR-58be38b8c7baa RBP1 antibody 100ul 707 € MBS mono human
GWB-BBF313 RBP1 antibody 1 vial 411 € genways human
GWB-F46054 RBP1 Over-expression Lysate reagent 1 vial 562 € genways human