Recombinant Human Cytotoxic T-lymphocyte Protein 4 (C-Fc-Avi)

Contact us
Catalog number: CU03
Price: 1801 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Cytotoxic T-lymphocyte Protein 4 (C-Fc-Avi)
Quantity: 100ug
Other quantities: 10 µg 100€ 50 µg 202€ 500 µg 659€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Avi tag at the C-terminus, Recombinant Human Cytotoxic T-lymphocyte Protein 4 is produced by our Mammalian expression system and the target gene encoding Lys36-Asp161 is expressed with a Fc &
Molecular Weight: 41, 5 kD
UniProt number: P16410
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDQEPKSSDKTHTSPPSPAPELLGGSSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Cytotoxic T-lymphocyte Protein 4 (C-Fc-Avi)
Short name: Recombinant Cytotoxic T-lymphocyte Protein 4 (C-Fc-Avi)
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens Cytotoxic T-lymphocyte Protein 4 (C-fragment c-Avi), recombinant H
Alternative technique: rec

Related Products :

CU03 Recombinant Human Cytotoxic T-lymphocyte Protein 4 (C-Fc-Avi) 10 µg 100 € novo human
GENTAUR-58ba800774e87 Agrobacterium vitis UPF0260 protein Avi_1324 (Avi_1324) 100ug 1520 € MBS Recombinant Proteins human
GENTAUR-58ba800801f0c Agrobacterium vitis UPF0260 protein Avi_1324 (Avi_1324) 1000ug 1520 € MBS Recombinant Proteins human
GENTAUR-58ba8008afbe7 Agrobacterium vitis UPF0260 protein Avi_1324 (Avi_1324) 100ug 2022 € MBS Recombinant Proteins human
GENTAUR-58ba80091fa97 Agrobacterium vitis UPF0260 protein Avi_1324 (Avi_1324) 1000ug 2022 € MBS Recombinant Proteins human
GENTAUR-58bb7cbe41859 Agrobacterium vitis UPF0262 protein Avi_0642 (Avi_0642) 100ug 1514 € MBS Recombinant Proteins human
GENTAUR-58bb7cbe8bc2f Agrobacterium vitis UPF0262 protein Avi_0642 (Avi_0642) 1000ug 1514 € MBS Recombinant Proteins human
GENTAUR-58bb7cbedf9ed Agrobacterium vitis UPF0262 protein Avi_0642 (Avi_0642) 100ug 2017 € MBS Recombinant Proteins human
GENTAUR-58bb7cbf1f619 Agrobacterium vitis UPF0262 protein Avi_0642 (Avi_0642) 1000ug 2017 € MBS Recombinant Proteins human
GENTAUR-58b8c4657ed77 Agrobacterium vitis UPF0283 membrane protein Avi_2471 (Avi_2471) 1000ug 1989 € MBS Recombinant Proteins human
GENTAUR-58b8c465efb73 Agrobacterium vitis UPF0283 membrane protein Avi_2471 (Avi_2471) 1000ug 2492 € MBS Recombinant Proteins human
GENTAUR-58b9c51c0c02d Agrobacterium vitis UPF0283 membrane protein Avi_2471 (Avi_2471) 1000ug 1989 € MBS Recombinant Proteins human
GENTAUR-58b9c51c70399 Agrobacterium vitis UPF0283 membrane protein Avi_2471 (Avi_2471) 1000ug 2492 € MBS Recombinant Proteins human
GENTAUR-58bb89d5c010b Agrobacterium vitis UPF0317 protein Avi_5849 (Avi_5849) 100ug 1790 € MBS Recombinant Proteins human
GENTAUR-58bb89d620d52 Agrobacterium vitis UPF0317 protein Avi_5849 (Avi_5849) 1000ug 1790 € MBS Recombinant Proteins human
GENTAUR-58bb89d65a712 Agrobacterium vitis UPF0317 protein Avi_5849 (Avi_5849) 100ug 2304 € MBS Recombinant Proteins human
GENTAUR-58bb89d6a0829 Agrobacterium vitis UPF0317 protein Avi_5849 (Avi_5849) 1000ug 2304 € MBS Recombinant Proteins human
GENTAUR-58b9df124b23f Agrobacterium vitis UPF0335 protein Avi_3695 (Avi_3695) 100ug 1332 € MBS Recombinant Proteins human
GENTAUR-58b9df1285223 Agrobacterium vitis UPF0335 protein Avi_3695 (Avi_3695) 1000ug 1332 € MBS Recombinant Proteins human
GENTAUR-58b9df13006b5 Agrobacterium vitis UPF0335 protein Avi_3695 (Avi_3695) 100ug 1835 € MBS Recombinant Proteins human
GENTAUR-58b9df135e055 Agrobacterium vitis UPF0335 protein Avi_3695 (Avi_3695) 1000ug 1835 € MBS Recombinant Proteins human
GENTAUR-58b37ce4a06be Agrobacterium vitis UPF0434 protein Avi_4243 (Avi_4243) 100ug 1271 € MBS Recombinant Proteins human
GENTAUR-58b37ce4cd599 Agrobacterium vitis UPF0434 protein Avi_4243 (Avi_4243) 1000ug 1271 € MBS Recombinant Proteins human
GENTAUR-58b37ce51416d Agrobacterium vitis UPF0434 protein Avi_4243 (Avi_4243) 100ug 1774 € MBS Recombinant Proteins human
GENTAUR-58b37ce53c14e Agrobacterium vitis UPF0434 protein Avi_4243 (Avi_4243) 1000ug 1774 € MBS Recombinant Proteins human
GENTAUR-58b4341831700 Agrobacterium vitis UPF0434 protein Avi_4243 (Avi_4243) 100ug 1271 € MBS Recombinant Proteins human
GENTAUR-58b4341862633 Agrobacterium vitis UPF0434 protein Avi_4243 (Avi_4243) 1000ug 1271 € MBS Recombinant Proteins human
GENTAUR-58b43418a2999 Agrobacterium vitis UPF0434 protein Avi_4243 (Avi_4243) 100ug 1774 € MBS Recombinant Proteins human
GENTAUR-58b43418cf6e5 Agrobacterium vitis UPF0434 protein Avi_4243 (Avi_4243) 1000ug 1774 € MBS Recombinant Proteins human
GENTAUR-58bc3e558b99e Agrobacterium vitis Putative phosphotransferase Avi_0001 (Avi_0001) 100ug 1801 € MBS Recombinant Proteins human