Recombinant Human Leukocyte Surface Antigen CD47 (C-Fc-Avi)

Contact us
Catalog number: CU01
Price: 1835 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Leukocyte Surface Antigen CD47 (C-Fc-Avi)
Quantity: 100ug
Other quantities: 10 µg 126€ 50 µg 278€ 500 µg 963€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Avi tag at the C-terminus, Recombinant Human Leukocyte Surface Antigen CD47 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro139 is expressed with a Fc &
Molecular Weight: 42, 7 kD
UniProt number: Q08722
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Leukocyte Surface CD47 (C-Fc-Avi)
Short name: Recombinant Leukocyte Surface Antigen CD47 (C-Fc-Avi)
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens Leukocyte Surface protein CD47 molecule (C-fragment c-Avi), recombinant H
Alternative technique: rec
Alternative to gene target: CD47 and IDBG-48744 and ENSG00000196776 and 961, CD47 and IDBG-631689 and ENSBTAG00000003585 and 282661, Cd47 and IDBG-165137 and ENSMUSG00000055447 and 16423, IAP and MER6 and OA3, Plasma membranes, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007229 and integrin-mediated signaling pathway and biological process this GO :0007596 and blood coagulation and biological process this GO :0008228 and opsonization and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0009617 and response to bacterium and biological process this GO :0022409 and positive regulation of cell-cell adhesion and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050766 and positive regulation of pha this GO cytosis and biological process this GO :0050870 and positive regulation of T cell activation and biological process this GO :0050900 and leukocyte migration and biological process this GO :0070053 and thrombospondin receptor activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0070053 : thrombospondin receptor activity, this GO :0070053 : thrombospondin receptor activity, thrombospondin receptor activity, CD47 molecule
Identity: 1682
Gene: CD47 | More about : CD47
Long gene name: CD47 molecule
Synonyms gene: MER6
Synonyms gene name: CD47 antigen (Rh-related antigen, integrin-associated signal transducer)
Synonyms: IAP OA3
Synonyms name: antigen identified by monoclonal antibody 1D8 antigenic surface determinant protein OA3 integrin associated protein Rh-related antigen leukocyte surface antigen CD47 CD47 glycoprotein
Locus: 3q13, 12
Discovery year: 1994-12-12
Entrez gene record: 961
Pubmed identfication: 8294396 2277087
RefSeq identity: NM_001777
Classification: Immunoglobulin like domain containing CD molecules
Havana BLAST/BLAT: OTTHUMG00000044216

Related Products :

CU01 Recombinant Human Leukocyte Surface Antigen CD47 (C-Fc-Avi) 10 µg 126 € novo human
AE51348PI-48 ELISA test for Pig Leukocyte surface antigen CD47 (CD47) 1x plate of 48 wells 402 € abebio pig
AE51348PI Pig Leukocyte surface antigen CD47 (CD47) ELISA Kit 96 wells plate 810 € ab-elisa elisas pig
AE51348PI-96 Pig Leukocyte surface antigen CD47 (CD47) ELISA Kit 1x plate of 96 wells 671 € abebio pig
CG18 Recombinant Human Leukocyte Surface Antigen CD47, IAP, OA3 (C-Fc) 1 mg 2486 € novo human
GWB-B0054E CD47 Antigen (Rh-related Antigen Integrin-associated Signal Transducer) (CD47) Mouse antibody to or anti-Human Monoclonal (HCD47) antibody 1 vial 602 € genways human
MBS620347 SLP-76, NT (SH2 Domain Containing Leukocyte Protein 76 kD, SH2 Domain-containing Leukocyte Protein of 76kD, SH2 Domain Containing Leukocyte Protein of 76kDa, SLP76, SLP76 Tyrosine Phosphoprotein, SLP-76 Tyrosine Phosphoprotein, 76kD Tyrosine Phosphoprotei 100ug 763 € MBS Polyclonals_1 human
GENTAUR-58bc3e558b99e Agrobacterium vitis Putative phosphotransferase Avi_0001 (Avi_0001) 100ug 1801 € MBS Recombinant Proteins human
GENTAUR-58bc3e55ba33f Agrobacterium vitis Putative phosphotransferase Avi_0001 (Avi_0001) 1000ug 1801 € MBS Recombinant Proteins human
GENTAUR-58bc3e5609fdf Agrobacterium vitis Putative phosphotransferase Avi_0001 (Avi_0001) 100ug 2315 € MBS Recombinant Proteins human
GENTAUR-58bc3e564d1ff Agrobacterium vitis Putative phosphotransferase Avi_0001 (Avi_0001) 1000ug 2315 € MBS Recombinant Proteins human
GENTAUR-58ba800774e87 Agrobacterium vitis UPF0260 protein Avi_1324 (Avi_1324) 100ug 1520 € MBS Recombinant Proteins human
GENTAUR-58ba800801f0c Agrobacterium vitis UPF0260 protein Avi_1324 (Avi_1324) 1000ug 1520 € MBS Recombinant Proteins human
GENTAUR-58ba8008afbe7 Agrobacterium vitis UPF0260 protein Avi_1324 (Avi_1324) 100ug 2022 € MBS Recombinant Proteins human
GENTAUR-58ba80091fa97 Agrobacterium vitis UPF0260 protein Avi_1324 (Avi_1324) 1000ug 2022 € MBS Recombinant Proteins human
GENTAUR-58bb7cbe41859 Agrobacterium vitis UPF0262 protein Avi_0642 (Avi_0642) 100ug 1514 € MBS Recombinant Proteins human
GENTAUR-58bb7cbe8bc2f Agrobacterium vitis UPF0262 protein Avi_0642 (Avi_0642) 1000ug 1514 € MBS Recombinant Proteins human
GENTAUR-58bb7cbedf9ed Agrobacterium vitis UPF0262 protein Avi_0642 (Avi_0642) 100ug 2017 € MBS Recombinant Proteins human
GENTAUR-58bb7cbf1f619 Agrobacterium vitis UPF0262 protein Avi_0642 (Avi_0642) 1000ug 2017 € MBS Recombinant Proteins human
GENTAUR-58b8c4657ed77 Agrobacterium vitis UPF0283 membrane protein Avi_2471 (Avi_2471) 1000ug 1989 € MBS Recombinant Proteins human
GENTAUR-58b8c465efb73 Agrobacterium vitis UPF0283 membrane protein Avi_2471 (Avi_2471) 1000ug 2492 € MBS Recombinant Proteins human
GENTAUR-58b9c51c0c02d Agrobacterium vitis UPF0283 membrane protein Avi_2471 (Avi_2471) 1000ug 1989 € MBS Recombinant Proteins human
GENTAUR-58b9c51c70399 Agrobacterium vitis UPF0283 membrane protein Avi_2471 (Avi_2471) 1000ug 2492 € MBS Recombinant Proteins human
GENTAUR-58bb89d5c010b Agrobacterium vitis UPF0317 protein Avi_5849 (Avi_5849) 100ug 1790 € MBS Recombinant Proteins human
GENTAUR-58bb89d620d52 Agrobacterium vitis UPF0317 protein Avi_5849 (Avi_5849) 1000ug 1790 € MBS Recombinant Proteins human
GENTAUR-58bb89d65a712 Agrobacterium vitis UPF0317 protein Avi_5849 (Avi_5849) 100ug 2304 € MBS Recombinant Proteins human
GENTAUR-58bb89d6a0829 Agrobacterium vitis UPF0317 protein Avi_5849 (Avi_5849) 1000ug 2304 € MBS Recombinant Proteins human
GENTAUR-58b9df124b23f Agrobacterium vitis UPF0335 protein Avi_3695 (Avi_3695) 100ug 1332 € MBS Recombinant Proteins human
GENTAUR-58b9df1285223 Agrobacterium vitis UPF0335 protein Avi_3695 (Avi_3695) 1000ug 1332 € MBS Recombinant Proteins human
GENTAUR-58b9df13006b5 Agrobacterium vitis UPF0335 protein Avi_3695 (Avi_3695) 100ug 1835 € MBS Recombinant Proteins human