Recombinant Human Decorin (Baculovirus)

Contact us
Catalog number: CS86
Price: 336 €
Supplier: Reliatech antibodies
Product name: Recombinant Human Decorin (Baculovirus)
Quantity: 100ug
Other quantities: 1 mg 912€ 10 µg 100€ 50 µg 202€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Decorin is produced by our Baculovirus expression system and the target gene encoding Gly17-Lys359 is expressed with a 6His tag at the C-terminus
Molecular Weight: 38, 8 kD
UniProt number: P07585
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Decorin (Baculovirus)
Short name: Recombinant Decorin (Baculovirus)
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens Decorin (Baculovirus), recombinant H
Alternative technique: rec

Related Products :

CS86 Recombinant Human Decorin (Baculovirus) 10 µg 100 € novo human
GWB-23B5A4 Recombinant Human Macrophage Colony Stimulating Factor Baculovirus bulk Ask price € genways bulk human
abx262208 Anti-Macrophage Colony Stimulating Factor, Baculovirus Protein (Recombinant) 10 µg 340 € abbex human
GWB-ATG017 mIgG, 98-330aa, mouse, His tag, Baculovirus, Recombinant Protein bulk Ask price € genways bulk human
GWB-P0557K H3N2/HA , 17-345 aa , Influenza A-H3N2 (human), His tag, Baculovirus bulk Ask price € genways bulk influenza
GWB-P0548B Antigen 85A , 43-338 aa , Mycobacterium tuberculosis, His tag, Baculovirus bulk Ask price € genways bulk human
GENTAUR-58be3954618a5 Baculovirus Envelope gp64 protein antibody (PE) 0.025 miligrams 404 € MBS mono human
GENTAUR-58be39553e49b Baculovirus Envelope gp64 protein antibody (PE) 100ug 669 € MBS mono human
GWB-EC6621 Baculovirus expression vector pAc-g-CH3 1 vial 971 € genways human
GWB-P0558L ESAT6 , 1-95 aa , Mycobacterium tuberculosis, His tag, Baculovirus bulk Ask price € genways bulk human
GWB-7676BB FlashBAC - Baculovirus Expression System (5 reactions) 1 tube 799 € genways human
GWB-6C34E3 FlashBAC - Baculovirus Expression System (96 reactions) 1 tube 5337 € genways human
GWB-EB1FF8 FlashBAC - Baculovirus Expression System(24 reactions) 1 vial 1895 € genways human
GWB-97BE6D FlashBAC Gold - Baculovirus Expression System (5 reactions) 1 vial 914 € genways human
GWB-FB2AFE FlashBAC Gold - Baculovirus Expression System (96 reactions) 1 vial 6469 € genways human
GWB-67B0AE FlashBAC Gold - Baculovirus Expression System(24 reactions) 1 tube 2265 € genways human
GWB-DC7364 flashBAC Ultra - Baculovirus Expression System (24 reactions) 1 vial 2658 € genways human
GWB-6AB80F flashBAC Ultra - Baculovirus Expression System (5 reactions) 1 tube 971 € genways human
GWB-P0550D H3N2/HA, 18-344aa , H3N2/HA (Canine), His tag, Baculovirus bulk Ask price € genways bulk human
GWB-P0541H H5N1/HA, 17-338aa , Influenza A (H5N1), His tag, Baculovirus bulk Ask price € genways bulk influenza
GWB-P0525E mIgG , 98-330aa , mouse, Baculovirus bulk Ask price € genways bulk human
CS83 Recombinant Human Decorin (C-6His) 10 µg 100 € novo human
RP-0549H Recombinant Human Decorin / DCN / SLRR1B Protein (Fc Tag) 100μg 624 € adv human
RP-0548H Recombinant Human Decorin / DCN / SLRR1B Protein (His Tag) 100μg 572 € adv human
abx261864 Anti-Borrelia Afzelii Decorin Binding Protein A (Recombinant) 1 mg 4675 € abbex human
abx261859 Anti-Borrelia Burgdorferi Decorin Binding Protein A (Recombinant) 5 µg 238 € abbex human
abx261861 Anti-Borrelia Burgdorferi Decorin Binding Protein B (Recombinant) 1 mg 4675 € abbex human
abx262651 Anti-Decorin Protein (Recombinant) 1 mg 6662 € abbex human
CM87 Recombinant Mouse Decorin, PGS2, PG40 (C-6His) 10 µg 80 € novo mouse
101-M376 Anti-Human Decorin 100ug 336 € Reliatech antibodies human