Recombinant Human SLAM Family Member 5, SLAMF5, CD84(C-6His)

Contact us
Catalog number: CS60
Price: 603 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human SLAM Family Member 5, SLAMF5, CD84(C-6His)
Quantity: 200ul
Other quantities: 1 mg 1674€ 10 µg 141€ 50 µg 303€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human SLAM Family Member 5 is produced by our Mammalian expression system and the target gene encoding Lys22-Arg220 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 23
UniProt number: Q9UIB8
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD84(C-6His), SLAMF5, SLAM Family Member 5
Short name: CD84(C-6His), SLAMF5, Recombinant SLAM Family Member 5
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD84 molecule(C-6His), SLAMF5, sapiens SLAM family Member 5, recombinant H
Alternative technique: rec
Alternative to gene target: CD84 and IDBG-104060 and ENSG00000066294 and 8832, CD84 and IDBG-630532 and ENSBTAG00000019033 and, Cd84 and IDBG-204869 and ENSMUSG00000038147 and 12523, Plasma membranes, hCD84 and LY9B and mCD84 and SLAMF5, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006952 and defense response and biological process this GO :0007156 and homophilic cell adhesion and biological process this GO :0007596 and blood coagulation and biological process this GO :0050900 and leukocyte migration and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD84 molecule
Identity: 1704
Gene: CD84 | More about : CD84
Long gene name: CD84 molecule
Synonyms gene name: CD84 antigen (leukocyte antigen) CD84 molecule
Synonyms: SLAMF5 hCD84 mCD84
Locus: 1q23, 3
Discovery year: 1999-01-18
GenBank acession: AF054816
Entrez gene record: 8832
Pubmed identfication: 9310491
RefSeq identity: NM_003874
Classification: Immunoglobulin like domain containing CD molecules
Havana BLAST/BLAT: OTTHUMG00000022788

Related Products :

CS60 Recombinant Human SLAM Family Member 5, SLAMF5, CD84(C-6His) 1 mg 1674 € novo human
CK72 Recombinant Mouse SLAM Family Member 5, SLAMF5, CD84(C-6His) 10 µg 146 € novo mouse
MBS620004 BLAME (B-lymphocyte activator macrophage expressed, Lymphocyte Activator Macrophage Expressed, Slam family member 8, SLAM-8, SLAMF8) Antibody 100ug 564 € MBS Polyclonals_1 human
CB90 Recombinant Human SLAM Family Member 2, CD48 (C-Fc-6His) 10 µg 146 € novo human
C387 Recombinant Human SLAM Family Member 6, SLAMF6, CD352, NTB-A (C-6His) 10 µg 121 € novo human
C316 Recombinant Human SLAM Family Member 7, SLAMF7, CD319, CRACC (C-6His) 500 µg 1613 € novo human
C771 Recombinant Human SLAM Family Member 8, BLAME, SLAMF8, BLAME (C-6His) 500 µg 1613 € novo human
CS51 Recombinant Mouse SLAM Family Member 2, CD48(C-6His) 500 µg 1613 € novo mouse
CS62 Recombinant Mouse SLAM Family Member 7, CRACC, SLAM7, CD319 (C-6His) 1 mg 1674 € novo mouse
CS65 Recombinant Mouse SLAM Family Member 8, SLAMF8 (C-6His) 10 µg 141 € novo mouse
C789 Recombinant Mouse SLAM Family Member 9, SLAMF9, CD2F-10 (C-6His) 500 µg 1613 € novo mouse
CP81 Recombinant Human SLAM Family Member 6, SLAMF6, CD352, NTB-A (C-Fc) 10 µg 141 € novo human
GENTAUR-58bdd5cdb2073 Anti- Signaling Lymphocytic Activation Molecule Family, Member 5 (SLAMF5) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd6d0504c1 Anti- Signaling Lymphocytic Activation Molecule Family, Member 5 (SLAMF5) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd6d7a3e20 Anti- Signaling Lymphocytic Activation Molecule Family, Member 5 (SLAMF5) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdd6d8241d6 Anti- Signaling Lymphocytic Activation Molecule Family, Member 5 (SLAMF5) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bd76b7600f1 Human SLAM family member 8 (SLAMF8) 100ug 1641 € MBS Recombinant Proteins human
GENTAUR-58bd76b7a5276 Human SLAM family member 8 (SLAMF8) 1000ug 1641 € MBS Recombinant Proteins human
GENTAUR-58bd76b7ec1b4 Human SLAM family member 8 (SLAMF8) 100ug 2155 € MBS Recombinant Proteins human
GENTAUR-58bd76b845d07 Human SLAM family member 8 (SLAMF8) 1000ug 2155 € MBS Recombinant Proteins human
MBS614674 NTB-A (SLAMF6, SLAM family member 6, Activating NK receptor, KALI, KALIb, Ly108, MGC104953, NK-T-B-antigen, NTBA, SF2000, UNQ6123/PRO20080) Antibody 100ug 774 € MBS Polyclonals_1 human
C309 Recombinant Human Signaling Lymphocytic Activation Molecule, SLAM, CD150 (C-6His) 50 µg 263 € novo human
CS22 Recombinant Mouse SLAM, CD150 (C-6His) 10 µg 146 € novo mouse
MBS620240 ABCA4 (ATP Binding Cassette Sub-family A Member 4, ATP-binding Cassette Sub-family A (ABC1) Member 4, ABCA 4, ABCR, ARMD 2, ARMD2, ATP Binding Cassette 10, ABC10, ATP-binding Transporter Retina Specific, CORD3, FFM, Photoreceptor Rim Protein, Retina-speci 100ug 509 € MBS Polyclonals_1 human
MBS619325 ABCB10 (ABCB10 ATP Binding Cassette, Sub-family B (MDR/TAP) Member 10, ATP-binding Cassette Sub-family B Member 10 Mitochondrial, ABCB 10, ATP-binding Cassette Transporter 10, ABC Transporter 10 Protein, EST20237, Mitochondrial ATP Binding Cassette 2, M A Antibody 100ug 707 € MBS Polyclonals_1 human
MBS620422 ABCB10 (ABCB10 ATP Binding Cassette, Sub-family B (MDR/TAP) Member 10, ATP-binding Cassette Sub-family B Member 10 Mitochondrial, ATP-binding Cassette Transporter 10, ABC Transporter 10 Protein, EST20237, Mitochondrial ATP Binding Cassette 2, M ABC2, M-AB 100ug 509 € MBS Polyclonals_1 human
MBS619748 Aldehyde Dehydrogenase Family 3, Member A2 (Aldh3A2, Aldehyde dehydrogenase, microsomal, Aldehyde dehydrogenase 10, Aldehyde dehydrogenase family 3 member A2, ALDH10, DKFZp686E23276, FALDH, Fatty aldehyde dehydrogenase, FLJ20851, SLS) Antibody 100ug 536 € MBS Polyclonals_1 human
MBS619554 aldo keto reductase family 1, member C2 (AKR1C2, 3-alpha-HSD3, AKR1C-pseudo, Aldo-keto reductase family 1 member C2, BABP, Chlordecone reductase homolog HAKRD, DD, DD/BABP, DD2, DDH2, Dihydrodiol dehydrogenase/bile acid-binding protein, Dihydrodiol dehydr Antibody 0.04 mg 370 € MBS Polyclonals_1 human
MBS624084 CFTR/MRP, (ATP-Binding Cassette, sub-family C, Member 13, PRED6, ABCC13 ATP-binding cassette, sub-family C (CFTR/MRP), member 13, pseudogene) Antibody 100ug 509 € MBS Polyclonals_1 human
MBS623700 CKIP-1, NT (Pleckstrin Homology Domain-containing Family O Member 1, PH Domain-containing Family O Member 1, Casein Kinase 2-interacting Protein 1, CK2-interacting Protein 1, CKIP-1, C-Jun-binding Protein, JBP, Osteoclast Maturation-associated Gene 120 Pr Antibody 200ul 603 € MBS Polyclonals_1 human