| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Low Affinity Immunoglobulin Gamma Fc Region Receptor II-A is produced by our Mammalian expression system and the target gene encoding Ala36-Ile218(His131Arg) is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
1 kD, 21 |
| UniProt number: |
P12318 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD32a (C-6His, FCGR2A, RIIa, Fc &gamma, H131) |
| Short name: |
CD32a (C-6His, FCGR2A, RIIa, H131), Recombinant Fc &gamma |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
CD32a (C-6His, RIIa, fragment c fragment on Immunoglobulin G, low affinity IIa, receptor (CD32), sapiens fragment c &gamma, H131), recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD32 and CD32A and CDw32 and FCG2 and FcGR and FCGR2 and FCGR2A1 and IGFR2, FCGR2A and IDBG-104282 and ENSG00000143226 and 2212, IgG binding, Plasma membranes, low affinity IIa, receptor (CD32), this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019864 and IgG binding and molecular function this GO :0038096 and Fc-gamma receptor signaling pathway involved in pha this GO cytosis and biological process this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0019864 : IgG binding, this GO :0019864 : IgG binding, 9103, Fc fragment of IgG |
| Identity: |
3616 |
| Gene: |
FCGR2A |
More about : FCGR2A |
| Long gene name: |
Fc fragment of IgG receptor IIa |
| Synonyms gene: |
FCG2 FCGR2A1 FCGR2 |
| Synonyms gene name: |
Fc fragment of IgG, low affinity IIa, low affinity IIa, receptor (CD32) , receptor for (CD32) Fc fragment of IgG |
| Synonyms: |
CD32 CD32A IGFR2 CDw32 |
| Synonyms name: |
Immunoglobulin G Fc receptor II Fc gamma receptor IIa |
| Locus: |
1q23, 3 |
| Discovery year: |
1988-11-30 |
| GenBank acession: |
J03619 |
| Entrez gene record: |
2212 |
| Pubmed identfication: |
2139735 |
| RefSeq identity: |
NM_021642 |
| Classification: |
CD molecules Immunoglobulin like domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000034469 |
| Locus Specific Databases: |
LRG_1109 |