Recombinant Human Fc γ RIIa, FCGR2A, CD32a (C-6His,H131)

Contact us
Catalog number: CS35
Price: 322 €
Supplier: ABM lentivectors
Product name: Recombinant Human Fc γ RIIa, FCGR2A, CD32a (C-6His,H131)
Quantity: 1.0 µg DNA
Other quantities: 10 µg 146€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Low Affinity Immunoglobulin Gamma Fc Region Receptor II-A is produced by our Mammalian expression system and the target gene encoding Ala36-Ile218(His131Arg) is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 21
UniProt number: P12318
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD32a (C-6His, FCGR2A, RIIa, Fc &gamma, H131)
Short name: CD32a (C-6His, FCGR2A, RIIa, H131), Recombinant Fc &gamma
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: CD32a (C-6His, RIIa, fragment c fragment on Immunoglobulin G, low affinity IIa, receptor (CD32), sapiens fragment c &gamma, H131), recombinant H
Alternative technique: rec
Alternative to gene target: CD32 and CD32A and CDw32 and FCG2 and FcGR and FCGR2 and FCGR2A1 and IGFR2, FCGR2A and IDBG-104282 and ENSG00000143226 and 2212, IgG binding, Plasma membranes, low affinity IIa, receptor (CD32), this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019864 and IgG binding and molecular function this GO :0038096 and Fc-gamma receptor signaling pathway involved in pha this GO cytosis and biological process this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0019864 : IgG binding, this GO :0019864 : IgG binding, 9103, Fc fragment of IgG
Identity: 3616
Gene: FCGR2A | More about : FCGR2A
Long gene name: Fc fragment of IgG receptor IIa
Synonyms gene: FCG2 FCGR2A1 FCGR2
Synonyms gene name: Fc fragment of IgG, low affinity IIa, low affinity IIa, receptor (CD32) , receptor for (CD32) Fc fragment of IgG
Synonyms: CD32 CD32A IGFR2 CDw32
Synonyms name: Immunoglobulin G Fc receptor II Fc gamma receptor IIa
Locus: 1q23, 3
Discovery year: 1988-11-30
GenBank acession: J03619
Entrez gene record: 2212
Pubmed identfication: 2139735
RefSeq identity: NM_021642
Classification: CD molecules Immunoglobulin like domain containing
Havana BLAST/BLAT: OTTHUMG00000034469
Locus Specific Databases: LRG_1109

Related Products :

CS35 Recombinant Human Fc γ RIIa, FCGR2A, CD32a (C-6His,H131) 50 µg 303 € novo human
C318 Recombinant Human Fc γ RIIa, FCGR2A, CD32a (C-6His) 1 mg 2283 € novo human
RP-1708H Recombinant Human CD32a / FCGR2A Protein (166 Arg, His Tag) 50μg 624 € adv human
RP-1707H Recombinant Human CD32a / FCGR2A Protein (167 Arg, Fc Tag) 50μg 624 € adv human
RP-1691H Recombinant Human CD32a / FCGR2A Protein (167 Arg, His & AVI Tag), Biotinylated 20μg 572 € adv human
RP-0316H Recombinant Human CD32a / FCGR2A Protein (167 Arg, His Tag) 50μg 624 € adv human
RP-1693H Recombinant Human CD32a / FCGR2A Protein (167 His, His & AVI Tag), Biotinylated 20μg 624 € adv human
RP-0315H Recombinant Human CD32a / FCGR2A Protein (167 His, His Tag) 50μg 624 € adv human
RP-1180RC Recombinant Cynomolgus CD32a / FCGR2A Protein (His & AVI Tag), Biotinylated 50μg 659 € adv human
RP-1182RC Recombinant Cynomolgus CD32a / FCGR2A Protein (His Tag) 50μg 659 € adv human
RP-1179RC Recombinant Rhesus CD32a / FCGR2A Protein (His Tag) 50μg 659 € adv rhesus
MBS620042 Tubulin, gamma (TUBG, Tubulin gamma 1 Chain, TUBG1, Tubulin gamma 2 Chain, TUBG2, Gamma 1 Tubulin, Gamma 2 Tubulin, Gamma Tubulin 1, Gamma Tubulin 2, Gamma Tubulin Complex Component 1, GCP 1, GCP-1, MGC131994, Xgam) (Cy3) Antibody 100ul 696 € MBS Polyclonals_1 human
C561 Recombinant Human Activin Receptor 2A, Activin RIIA, ACVR2A (C-6His) 500 µg 1613 € novo human
CB60 Recombinant Human Activin Receptor 2A, Activin RIIA, ACVR2A (C-Fc-6His) 10 µg 100 € novo human
abx263270 Anti-CD32a Protein (Recombinant) 100 µg 1674 € abbex human
MBS551279 Human CD32a Affinity Purified Polyclonal Antibody 1000ug 2420 € MBS Polyclonals_1 human
GENTAUR-58bd03905c3be Human RIIa domain-containing protein 1 (RIIAD1) 100ug 1348 € MBS Recombinant Proteins human
GENTAUR-58bd0390aa3aa Human RIIa domain-containing protein 1 (RIIAD1) 1000ug 1348 € MBS Recombinant Proteins human
GENTAUR-58bd039106dfd Human RIIa domain-containing protein 1 (RIIAD1) 100ug 1851 € MBS Recombinant Proteins human
GENTAUR-58bd039156919 Human RIIa domain-containing protein 1 (RIIAD1) 1000ug 1851 € MBS Recombinant Proteins human
GENTAUR-58bde86d0fa60 Mouse Monoclonal [clone 13D7] (IgG2b) to Human CD32A Antibody 0.05 ml 597 € MBS mono human
MBS621590 Activin Receptor Type IIA (RIIA) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS622684 Activin Receptor Type IIA (RIIA) (Biotin) Antibody 50ug 818 € MBS Polyclonals_1 human
GENTAUR-58bd871d1aedf Bovine RIIa domain-containing protein 1 (RIIAD1) 100ug 1348 € MBS Recombinant Proteins bovine
GENTAUR-58bd871d82e4f Bovine RIIa domain-containing protein 1 (RIIAD1) 1000ug 1348 € MBS Recombinant Proteins bovine
GENTAUR-58bd871deb4ec Bovine RIIa domain-containing protein 1 (RIIAD1) 100ug 1851 € MBS Recombinant Proteins bovine
GENTAUR-58bd871e65824 Bovine RIIa domain-containing protein 1 (RIIAD1) 1000ug 1851 € MBS Recombinant Proteins bovine
MBS611055 Heterochromatin Protein 1 gamma, (CBX3, chromobox homolog 3 (HP1 gamma homolog, Drosophila), HGNC:1553, HECH, HP1-GAMMA, HP1Hs-gamma, HP1 gamma homolog, chromobox homolog 3, chromobox homolog 3 (Drosophila HP1 gamma), heterochromatin protein HP1 gamma, he Antibody 100ug 591 € MBS Polyclonals_1 drosophila
GWB-PPST24 FCGR2A, 34-216aa Human, His tag, E.coli bulk Ask price € genways bulk human
LV158766 FCGR2A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human