Recombinant Human Interleukin-28B, IL-28B, IFN-lambda 3

Contact us
Catalog number: CS26
Price: Ask price €
Supplier: accurate-monoclonals
Product name: Recombinant Human Interleukin-28B, IL-28B, IFN-lambda 3
Quantity: vial
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Interleukin-28B is produced by our Mammalian expression system and the target gene encoding Val22-Val196 is expressed
Molecular Weight: 19, 6 kD
UniProt number: Q8IZI9
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM EDTA, 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: IFN-lambda 3, IL-28B, Interleukin-28B
Short name: IFN-lambda 3, IL-28B, Recombinant Interleukin-28B
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Interferon-lambda 3, Interleukin-28B, sapiens Interleukin-28B, recombinant H
Alternative technique: rec
Identity: 18365
Gene: IFNL3 | More about : IFNL3
Long gene name: interferon lambda 3
Synonyms gene: IL28B
Synonyms gene name: interleukin 28B interleukin 28B (interferon, lambda 3)
Synonyms: IL-28B IL28C
Locus: 19q13, 2
Discovery year: 2002-12-02
GenBank acession: AY129149
Entrez gene record: 282617
RefSeq identity: NM_172139
Classification: Interferons
Havana BLAST/BLAT: OTTHUMG00000182805
Locus Specific Databases: LRG_1011

Related Products :

CS26 Recombinant Human Interleukin-28B, IL-28B, IFN-lambda 3 500 µg 1613 € novo human
CA25 Recombinant Human Interleukin-28B, IL-28B, IFN-lambda 3 (C-6His) 1 mg 2283 € novo human
AE38299HU-48 ELISA test for Human Interleukin 28B (IL-28B) 1x plate of 48 wells 373 € abebio human
AE38299HU Human Interleukin 28B (IL-28B) ELISA Kit 48 wells plate 480 € ab-elisa elisas human
AE38299HU-96 Human Interleukin 28B (IL-28B) ELISA Kit 1x plate of 96 wells 612 € abebio human
RP-0902H Recombinant Human IL-28B / IFN-lambda-3 Protein (His Tag) 20μg 572 € adv human
AE38297RA-48 ELISA test for Rat Interleukin 28B (IL-28B) 1x plate of 48 wells 373 € abebio rat
AE38297RA Rat Interleukin 28B (IL-28B) ELISA Kit 48 wells plate 465 € ab-elisa elisas rat
AE38297RA-96 Rat Interleukin 28B (IL-28B) ELISA Kit 1x plate of 96 wells 612 € abebio rat
PBL61840-1 anti-DIY Human IFN Lambda 1/2/3 (IL-29/28A/28B) ELISA Kit Antibody 15 Plates 1138 € acr human
MBS624050 IL29 (Interleukin-29, IL-29, Interferon lambda-1, IFN-lambda-1, Cytokine ZCYTO21, FNL1, ZCYTO21, IL29) Antibody 200ul 597 € MBS Polyclonals_1 human
RP-0829H Recombinant Human IFN-alpha / IFNA1 / IFN Protein (His Tag) 20μg 456 € adv human
RP-0835H Recombinant Human IFN-gamma / IFNG / γ-IFN Protein 20μg 346 € adv human
PBL61830-1 anti-DIY Interleukin-28A/B (IFN-Lambda 2/3) ELISA Kit Antibody 15 Plates 1138 € acr human
abx574443 Anti-Human Interleukin 28B (IL28B) ELISA Kit 96 tests 717 € abbex human
DL-IL28B-Hu Human Interleukin 28B IL28B ELISA Kit 96T 846 € DL elisas human
C668 Recombinant Human Interferon Lambda-1, IL-29, IFN-λ1 (C-10His) 10 µg 126 € novo human
AR51900PU-N anti-Interleukin-28B (22-196, His-tag) Antibody 0,25 mg 1413 € acr human
AR51900PU-S anti-Interleukin-28B (22-196, His-tag) Antibody 50 Вµg 485 € acr human
PBL12820-1 anti-Interleukin-28B Antibody 25 Вµg 775 € acr human
PBL12821-1 anti-Interleukin-28B Antibody 25 Вµg 775 € acr human
GENTAUR-58bdc13e23fdb Anti- Interleukin 28B (IL28B) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc14006996 Anti- Interleukin 28B (IL28B) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdcd44d5a20 Anti- Interleukin 28B (IL28B) Antibody 100ug 520 € MBS Polyclonals human
AP52195PU-N anti-Interleukin-28B (N-term) Antibody 0,4 ml 587 € acr human
EKU05311 Interleukin 28B (IL28B) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
ZR-40-444 IFN lambda 2 Recombinant Protein 0.005 mg 256 € Zyagen human
PBL62830-1 anti-DIY Mouse IFN Lambda 2/3 (IL-28A/B) ELISA Kit Antibody 15 Plates 1138 € acr mouse
BMALAMBDA1B Lambda, Clone: lambda-1, Mouse Monoclonal antibody-Human, Biotin; paraffin (plasma cells only) 0.1mg Ask price € accurate-monoclonals human
BMALAMBDA1F Lambda, Clone: lambda-1, Mouse Monoclonal antibody-Human, FITC; paraffin (plasma cells only) vial Ask price € accurate-monoclonals human