Recombinant Human 4-1BB Ligand, 4-1BBL, TNFSF9, CD137L (N-Fc)

Contact us
Catalog number: CS18
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Human 4-1BB Ligand, 4-1BBL, TNFSF9, CD137L (N-Fc)
Quantity: 0.1ml
Other quantities: 1 mg 2283€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Receptor agonists are often tested for drug development, FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling
Molecular Weight: 1 kD, 46
UniProt number: P41273
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGRREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: 4-1BBL, CD137L (N-Fc), TNFSF9, 4-1BB Ligand
Short name: 4-1BBL, CD137L (N-Fc), TNFSF9, Recombinant 4-1BB Ligand
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: 4-1BBL, CD137L (N-fragment c), member 9, sapiens 4-1BB Ligand, tumor necrosis factor (ligand) superfamily, recombinant H
Alternative technique: rec
Alternative to gene target: 4-1BB-L and CD137L, Extracellular, TNFSF9 and IDBG-21688 and ENSG00000125657 and 8744, TNFSF9 and IDBG-643947 and ENSBTAG00000046266 and 521748, Tnfsf9 and IDBG-193693 and ENSMUSG00000035678 and 21950, member 9, this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008283 and cell proliferation and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0032729 and positive regulation of interferon-gamma production and biological process this GO :0032735 and positive regulation of interleukin-12 production and biological process this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0032813 and tumor necrosis factor receptor superfamily binding and molecular function this GO :0042104 and positive regulation of activated T cell proliferation and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0043011 and myeloid dendritic cell differentiation and biological process this GO :0045087 and innate immune response and biological process this GO :0045585 and positive regulation of cytotoxic T cell differentiation and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding and also this GO :0032813 : tumor necrosis factor receptor superfamily binding, this GO :0005125 : cytokine activity, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005515 : protein binding, this GO :0032813 : tumor necrosis factor receptor superfamily binding, tumor necrosis factor receptor superfamily binding, tumor necrosis factor (ligand) superfamily
Identity: 11939
Gene: TNFSF9 | More about : TNFSF9
Long gene name: tumor necrosis factor superfamily member 9
Synonyms gene name: member 9 , tumor necrosis factor (ligand) superfamily
Synonyms: 4-1BB-L
Synonyms name: receptor 4-1BB ligand homolog of mouse 4-1BB-L
Locus: 19p13, 3
Discovery year: 1998-12-04
GenBank acession: U03398
Entrez gene record: 8744
Pubmed identfication: 8405064 8088337
RefSeq identity: NM_003811
Classification: Tumor necrosis factor superfamily
Havana BLAST/BLAT: OTTHUMG00000181831

Related Products :

CH04 Recombinant Human 4-1BB Ligand, 4-1BBL, TNFSF9, CD137L (C-6His) 500 µg 1613 € novo human
CS18 Recombinant Human 4-1BB Ligand, 4-1BBL, TNFSF9, CD137L (N-Fc) 1 mg 2283 € novo human
YSRTMCA2286 CD137L, 4-1BB Ligand, 50kD, Clone: AT113-2, Rat Mouse Monoclonal antibody-Mouse; flow/IP 0.25 mg 391 € accurate-monoclonals mouse
YSRTMCA2286T CD137L, 4-1BB Ligand, 50kD, Clone: AT113-2, Rat Mouse Monoclonal antibody-Mouse; flow/IP 25 ug 119 € accurate-monoclonals mouse
YSRTMCA2286PE CD137L, 4-1BB Ligand, 50kD, Clone: AT113-2, Rat Mouse Monoclonal antibody-Mouse; flow/IP, PE conj. vial 479 € accurate-monoclonals mouse
YSRTMCA2286PET CD137L, 4-1BB Ligand, 50kD, Clone: AT113-2, Rat Mouse Monoclonal antibody-Mouse; flow/IP, PE conj. vial 177 € accurate-monoclonals mouse
AR09189PU-L anti-4-1BBL / TNFSF9 (71-254, His-tag) Antibody 0,5 mg 1138 € acr human
AR09189PU-N anti-4-1BBL / TNFSF9 (71-254, His-tag) Antibody 0,1 mg 485 € acr human
AP20383PU-N anti-4-1BBL / TNFSF9 Antibody 0,1 mg 558 € acr human
C10600-1 anti-4-1BBL / TNFSF9 Antibody 50 Вµg 347 € acr human
C10600-2 anti-4-1BBL / TNFSF9 Antibody 0,1 mg 500 € acr human
CPA3360-100ul anti-4-1BBL / TNFSF9 Antibody 0,1 ml 442 € acr human
CPA3360-200ul anti-4-1BBL / TNFSF9 Antibody 0,2 ml 688 € acr human
CPA3360-30ul anti-4-1BBL / TNFSF9 Antibody 30 Вµl 326 € acr human
SM2027P anti-4-1BBL / TNFSF9 Antibody 0,25 mg 630 € acr human
SM2027PT anti-4-1BBL / TNFSF9 Antibody 25 Вµg 297 € acr human
SM2027R anti-4-1BBL / TNFSF9 Antibody 100 Tests 529 € acr human
SM2027RT anti-4-1BBL / TNFSF9 Antibody 25 Tests 355 € acr human
DM3534P anti-4-1BBL / TNFSF9 (Extracell. Dom.) Antibody 0,1 mg 688 € acr human
MBS247806 PAb (IgG) to Human TNFSF9 / CD137L 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58be621e0f2ae Anti-TNFSF9/CD137L (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
bs-3851R-A350 TNFSF9/CD137L Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3851R-A488 TNFSF9/CD137L Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3851R-A555 TNFSF9/CD137L Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3851R-A594 TNFSF9/CD137L Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3851R-A647 TNFSF9/CD137L Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3851R-Biotin TNFSF9/CD137L Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-3851R TNFSF9/CD137L Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-3851R-Cy3 TNFSF9/CD137L Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-3851R-Cy5 TNFSF9/CD137L Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human