| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Heparin Binding EGF like Growth Factor is produced by our Mammalian expression system and the target gene encoding Leu20-Leu148 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
1 kD, 15 |
| UniProt number: |
Q99075 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH4O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to﹠௬ڰ௬ۀౌ_x005F_xFFFF_翿ñ, Always centrifuge tubes before opening, g/ml, ɋ_x005F_x0008_ȡȡ_x005F_x0007__x005F_x0008_roi |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
proHB-EGF(C-6His), Heparin Binding EGF like Growth Factor |
| Short name: |
proHB-EGF(C-6His), Recombinant Heparin Binding EGF like Growth Factor |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
proHB-epidermal growth factor(C-6His), sapiens Heparin Binding epidermal growth factor like Growth Factor, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
DNA-templated and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048754 and branching morphogenesis of an epithelial tube and biological process this GO :0050730 and regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0051048 and negative regulation of secretion and biological process this GO :0060749 and mammary gland alveolus development and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070371 and ERK1 and ERK2 cascade and biological process this GO :0090279 and regulation of calcium ion import and biological process this GO :0090370 and negative regulation of cholesterol efflux and biological process this GO :1900127 and positive regulation of hyaluronan biosynthetic process and biological process this GO :2000008 and regulation of protein localization to cell surface and biological process this GO :2000060 and positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process and biological process, EGF and IDBG-34100 and ENSG00000138798 and 1950, Egf and IDBG-193432 and ENSMUSG00000028017 and 13645, Extracellular, HOMG4 and URG, this GO :0000186 and activation of MAPKK activity and biological process this GO :0001525 and angiogenesis and biological process this GO :0002576 and platelet degranulation and biological process this GO :0005154 and epidermal growth factor receptor binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005765 and lysosomal membrane and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006260 and DNA replication and biological process this GO :0007165 and signal transduction and biological process this GO :0007171 and activation of transmembrane receptor protein tyrosine kinase activity and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007262 and STAT protein import into nucleus and biological process this GO :0007596 and blood coagulation and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0010800 and positive regulation of peptidyl-threonine phosphorylation and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0018108 and peptidyl-tyrosine phosphorylation and biological process this GO :0021940 and positive regulation of cerebellar granule cell precursor proliferation and biological process this GO :0030168 and platelet activation and biological process this GO :0030297 and transmembrane receptor protein tyrosine kinase activator activity and molecular function this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0035413 and positive regulation of catenin import into nucleus and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042059 and negative regulation of epidermal growth factor receptor signaling pathway and biological process this GO :0042327 and positive regulation of phosphorylation and biological process this GO :0043388 and positive regulation of DNA binding and biological process this GO :0043406 and positive regulation of MAP kinase activity and biological process this GO :0045087 and innate immune response and biological process this GO :0045741 and positive regulation of epidermal growth factor-activated receptor activity and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045893 and positive regulation of transcription, this GO :0005154 : epidermal growth factor receptor binding, this GO :0005154 : epidermal growth factor receptor binding and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0030297 : transmembrane receptor protein tyrosine kinase activator activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0030297 : transmembrane receptor protein tyrosine kinase activator activity, transmembrane receptor protein tyrosine kinase activator activity, epidermal growth factor |
| Identity: |
3229 |
| Gene: |
EGF |
More about : EGF |
| Long gene name: |
epidermal growth factor |
| Synonyms gene name: |
epidermal growth factor (beta-urogastrone) |
| Locus: |
4q25 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
X04571 |
| Entrez gene record: |
1950 |
| Havana BLAST/BLAT: |
OTTHUMG00000132044 |