Recombinant Human S100A16

Contact us
Catalog number: CR33
Price: 844 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Human S100A16
Quantity: 1 plate of 96 wells
Other quantities: 1 mg 1268€ 50 µg 263€ 500 µg 902€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Protein S100-A16 is produced by our E, coli expression system and the target gene encoding Met1-Ser103 is expressed
Molecular Weight: 11, 8 kD
UniProt number: Q96FQ6
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 500 mM sodium chloride, pH8, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: S100A16
Short name: Recombinant S100A16
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens S100A16, recombinant H
Alternative technique: rec
Identity: 20846
Gene: HRNR | More about : HRNR
Long gene name: hornerin
Synonyms: S100a18 S100A16 FLG3
Synonyms name: filaggrin family member 3
Locus: 1q21, 3
Discovery year: 2004-10-05
GenBank acession: AB104446
Entrez gene record: 388697
RefSeq identity: XM_373868
Classification: S100 fused type protein family EF-hand domain containing
Havana BLAST/BLAT: OTTHUMG00000012243

Related Products :

CR33 Recombinant Human S100A16 50 µg 263 € novo human
RP-1345H Recombinant Human S100A16 / S100F Protein 50μg 624 € adv human
abx166029 Anti-S100A16 (Recombinant) 10 μg 427 € abbex human
GWB-P1020F S100A16, 1-103aa, Recombinant Protein bulk Ask price € genways bulk human
abx156848 Anti-Human S100A16 ELISA Kit inquire 50 € abbex human
GWB-ASE888 Human S100A16 Antibody bulk Ask price € genways bulk human
MBS248987 PAb (IgG) to Human S100A16 Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-BSP639 S100A16 Human Protein bulk Ask price € genways bulk human
LV294884 S100A16 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
abx258010 Anti-Mouse S100A16 ELISA Kit 96 tests 949 € abbex mouse
abx258081 Anti-Rat S100A16 ELISA Kit inquire 50 € abbex rat
GENTAUR-58bdc96a23e81 Anti- S100 Calcium Binding Protein A16 (S100A16) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdcdf4f1c03 Anti- S100 Calcium Binding Protein A16 (S100A16) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdcdf54f465 Anti- S100 Calcium Binding Protein A16 (S100A16) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bddc3cc0515 Anti- S100 Calcium Binding Protein A16 (S100A16) Antibody 100ug 564 € MBS Polyclonals human
AR09958PU-L anti-S100A16 (1-103, His-tag) Antibody 0,5 mg 1138 € acr human
AR09958PU-N anti-S100A16 (1-103, His-tag) Antibody 0,1 mg 485 € acr human
A04S0002 anti-S100A16 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
C18044-1 anti-S100A16 Antibody 50 Вµg 347 € acr human
C18044-2 anti-S100A16 Antibody 0,1 mg 500 € acr human
CPA4515-100ul anti-S100A16 Antibody 0,1 ml 442 € acr human
CPA4515-200ul anti-S100A16 Antibody 0,2 ml 688 € acr human
CPA4515-30ul anti-S100A16 Antibody 30 Вµl 326 € acr human
GENTAUR-58be56698c978 Anti- S100A16 Antibody 0.2 mg 663 € MBS Polyclonals human
GENTAUR-58be5669e8056 Anti- S100A16 Antibody 50ug 365 € MBS Polyclonals human
abx130127 Anti-S100A16 Antibody 100 μg 557 € abbex human
abx218412 Anti-S100A16 Antibody inquire 50 € abbex human
abx932346 Anti-S100A16 siRNA inquire 50 € abbex human
EKU08442 S100 Calcium Binding Protein A16 (S100A16) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
EKU08512 S100 Calcium Binding Protein A16 (S100A16) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human