Recombinant Human S100A11

Contact us
Catalog number: CR32
Price: 332 €
Supplier: MBS Polyclonals
Product name: Recombinant Human S100A11
Quantity: 50ug
Other quantities: 1 mg 1877€ 50 µg 369€ 500 µg 1328€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Protein S100-A11 is produced by our E, coli expression system and the target gene encoding Met1-Thr105 is expressed
Molecular Weight: 11, 7 kD
UniProt number: P31949
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: S100A11
Short name: Recombinant S100A11
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens S100A11, recombinant H
Alternative technique: rec
Identity: 10488
Gene: S100A11 | More about : S100A11
Long gene name: S100 calcium binding protein A11
Synonyms gene name: S100 calcium-binding protein A11 (calgizzarin) S100 calcium binding protein A11 (calgizzarin)
Synonyms: S100C
Locus: 1q21, 3
Discovery year: 1997-10-30
GenBank acession: D38583
Entrez gene record: 6282
Pubmed identfication: 8985590
RefSeq identity: NM_005620
Classification: S100 calcium binding proteins EF-hand domain containing
Havana BLAST/BLAT: OTTHUMG00000013069

Related Products :

RP-839 Recombinant Human S100 Calcium Binding Protein A11 (S100A11) 10 μg 333 € adi human
CR32 Recombinant Human S100A11 1 mg 1877 € novo human
RP-1341H Recombinant Human S100A11 / S100C Protein 20μg 572 € adv human
abx166036 Anti-S100A11 (Recombinant) 50 μg 659 € abbex human
CR31 Recombinant Mouse S100A11 (N-6His) 50 µg 202 € novo mouse
RP-1481M Recombinant Mouse S100A11 / S100C Protein (His Tag) 20μg 456 € adv mouse
GWB-P1070D S100A11, 1-105aa, Recombinant Protein bulk Ask price € genways bulk human
abx152997 Anti-Human S100A11 ELISA Kit 96 tests 775 € abbex human
abx570392 Anti-Human S100A11 ELISA Kit inquire 50 € abbex human
DL-S100A11-Hu Human S100 Calcium Binding Protein A11 S100A11 ELISA Kit 96T 788 € DL elisas human
GWB-D4ED30 S100A11 Human bulk Ask price € genways bulk human
LV815583 S100A11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
abx255396 Anti-Monkey S100A11 ELISA Kit 96 tests 557 € abbex monkey
abx154628 Anti-Mouse S100A11 ELISA Kit inquire 50 € abbex mouse
abx254393 Anti-Mouse S100A11 ELISA Kit 96 tests 557 € abbex mouse
abx576012 Anti-Mouse S100A11 ELISA Kit 96 tests 746 € abbex mouse
abx255555 Anti-Pig S100A11 ELISA Kit inquire 50 € abbex pig
abx257072 Anti-Rabbit S100A11 ELISA Kit inquire 50 € abbex human
abx573284 Anti-Rabbit S100A11 ELISA Kit inquire 50 € abbex human
abx156058 Anti-Rat S100A11 ELISA Kit inquire 50 € abbex rat
abx255982 Anti-Rat S100A11 ELISA Kit inquire 50 € abbex rat
abx573850 Anti-Rat S100A11 ELISA Kit 96 tests 775 € abbex rat
GENTAUR-58bdc3d256d6d Anti- S100 Calcium Binding Protein A11 (S100A11) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc4283a268 Anti- S100 Calcium Binding Protein A11 (S100A11) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc42882317 Anti- S100 Calcium Binding Protein A11 (S100A11) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc4b5d7a48 Anti- S100 Calcium Binding Protein A11 (S100A11) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc4b651104 Anti- S100 Calcium Binding Protein A11 (S100A11) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdc7091bf1b Anti- S100 Calcium Binding Protein A11 (S100A11) Antibody 100ug 608 € MBS Polyclonals human
GENTAUR-58bdc71aa5214 Anti- S100 Calcium Binding Protein A11 (S100A11) Antibody 100ug 409 € MBS Polyclonals human
GENTAUR-58bdc71b05fe9 Anti- S100 Calcium Binding Protein A11 (S100A11) Antibody 50ug 332 € MBS Polyclonals human