| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human KIR2DL3 is produced by our Mammalian expression system and the target gene encoding His22-His245 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
25, 4 kD |
| UniProt number: |
P43628 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWLSPTEPSSETGNPRHLHHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD158b2 (C-6His), NKAT2, KIR2DL3 |
| Short name: |
CD158b2 (C-6His), NKAT2, Recombinant KIR2DL3 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
3, CD158b2 (C-6His), NKAT2, large cytoplasmic tail, sapiens killer cellular immunoglobulin-like receptor, two domains, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
3, CD158b and CD158B2 and GL183 and KIR-023GB and KIR-K7b and KIR-K7c and KIR2DS5 and KIRCL23 and NKAT and NKAT2 and NKAT2A and NKAT2B and p58, KIR2DL3 and IDBG-409456 and ENSG00000243772 and 3804, Plasma membranes, long cytoplasmic tail, protein binding, this GO :0003823 and antigen binding and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0050776 and regulation of immune response and biological process, this GO :0003823 : antigen binding, this GO :0003823 : antigen binding and also this GO :0004872 : receptor activity and also this GO :0005515 : protein binding, this GO :0004872 : receptor activity, this GO :0005515 : protein binding, two domains, killer cell immunoglobulin-like receptor |
| Identity: |
6331 |
| Gene: |
KIR2DL3 |
More about : KIR2DL3 |
| Long gene name: |
killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 3 |
| Synonyms gene name: |
3 , killer cell immunoglobulin-like receptor, long cytoplasmic tail, two domains |
| Synonyms: |
cl-6 nkat2 nkat2a nkat2b p58 CD158B2 |
| Locus: |
19q13, 42 |
| Discovery year: |
1997-11-14 |
| GenBank acession: |
L41268 |
| Entrez gene record: |
3804 |
| Pubmed identfication: |
7749980 8662091 |
| Classification: |
Killer cell immunoglobulin like receptors CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000065887 |
| Locus Specific Databases: |
IPD-KIR Database |