| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human 4-1BB ligand receptor is produced by our Mammalian expression system and the target gene encoding Leu24-Gln186 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
1 kD, 18 |
| UniProt number: |
Q07011 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD137 (C-6His), TNFRSF9, 4-1BB |
| Short name: |
CD137 (C-6His), TNFRSF9, Recombinant 4-1BB |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD137 (C-6His), member 9, sapiens 4-1BB, tumor necrosis factor receptor superfamily, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
4-1BB and CD137 and CDw137 and ILA, BT, Extracellular, TNFRSF9 and IDBG-88268 and ENSG00000049249 and 3604, Tnfrsf9 and IDBG-205902 and ENSMUSG00000028965 and 21942, cytokine binding, member 9, this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0019955 and cytokine binding and molecular function this GO :0042127 and regulation of cell proliferation and biological process this GO :0045087 and innate immune response and biological process this GO :0070207 and protein homotrimerization and biological process this GO :2001180 and negative regulation of interleukin-10 secretion and biological process this GO :2001183 and negative regulation of interleukin-12 secretion and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005515 : protein binding and also this GO :0019955 : cytokine binding, this GO :0005515 : protein binding, this GO :0019955 : cytokine binding, 49346 and IDBG-633668 and ENSBTAG00000003313 and 520341, tumor necrosis factor receptor superfamily |
| Identity: |
11924 |
| Gene: |
TNFRSF9 |
More about : TNFRSF9 |
| Long gene name: |
TNF receptor superfamily member 9 |
| Synonyms gene: |
ILA |
| Synonyms gene name: |
member 9 , tumor necrosis factor receptor superfamily |
| Synonyms: |
CD137 4-1BB |
| Locus: |
1p36, 23 |
| Discovery year: |
1996-06-12 |
| GenBank acession: |
L12964 |
| Entrez gene record: |
3604 |
| Pubmed identfication: |
8262389 8639902 |
| Classification: |
CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000001223 |