Recombinant Mouse Complement Component C3a, C3a

Contact us
Catalog number: CM99
Price: 883 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Mouse Complement Component C3a, C3a
Quantity: 1 plate of 96 wells
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Complement Component C3a is produced by our E, coli expression system and the target gene encoding Ser671-Arg748 is expressed
Molecular Weight: 2 kD, 9
UniProt number: P01027
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: C3a, Complement Component C3a
Short name: C3a, Recombinant Mouse Complement Component C3a
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: C3a, recombinant Mouse Complement Component C3a
Alternative technique: rec

Related Products :

CM99 Recombinant Mouse Complement Component C3a, C3a 10 µg 156 € novo mouse
CP21 Recombinant Human Complement Component C3a, C3a 10 µg 156 € novo human
GAU013-16 C3a/C3a (desArg) Complement component, Clone: GAU013-16, Mouse Monoclonal antibody-Human 0.2mg 1234 € accurate-monoclonals human
GAU017-01 C3a/C3a (desArg) Complement component, Clone: GAU017-01, Mouse Monoclonal antibody-Human 0.2mg 1234 € accurate-monoclonals human
GAU017-01B C3a/C3a (desArg) Complement component, Clone: GAU017-01, Mouse Monoclonal antibody-Human, Biotin 0.1mg 1926 € accurate-monoclonals human
abx575425 Anti-Mouse Complement Component 3a (C3a) ELISA Kit inquire 50 € abbex mouse
DL-C3a-Mu Mouse Complement Component 3a C3a ELISA Kit 96T 869 € DL elisas mouse
KT-11823 Mouse Complement Component 3a (C3a) ELISA kit 96 well plate 1138 € Kamiya mouse
GENTAUR-58bdce5b53b52 Anti- Complement Component 3a (C3a) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdce5bc1f47 Anti- Complement Component 3a (C3a) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdce6988519 Anti- Complement Component 3a (C3a) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdce69ebed3 Anti- Complement Component 3a (C3a) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdd20c8ff78 Anti- Complement Component 3a (C3a) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd23af2e60 Anti- Complement Component 3a (C3a) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd5ba70958 Anti- Complement Component 3a (C3a) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd703ec793 Anti- Complement Component 3a (C3a) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddaf0008ab Anti- Complement Component 3a (C3a) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bddaf05239d Anti- Complement Component 3a (C3a) Antibody 100ug 448 € MBS Polyclonals human
GENTAUR-58bddb10f3efd Anti- Complement Component 3a (C3a) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bddd2432531 Anti- Complement Component 3a (C3a) Antibody 100ug 520 € MBS Polyclonals human
abx575890 Anti-Dog Complement Component 3a (C3a) ELISA Kit inquire 50 € abbex dog
abx575424 Anti-Human Complement Component 3a (C3a) ELISA Kit inquire 50 € abbex human
abx573642 Anti-Pig Complement Component 3a (C3a) ELISA Kit inquire 50 € abbex pig
abx576084 Anti-Rabbit Complement Component 3a (C3a) ELISA Kit inquire 50 € abbex human
abx573244 Anti-Rat Complement Component 3a (C3a) ELISA Kit inquire 50 € abbex rat
DL-C3a-c Canine Complement Component 3a C3a ELISA Kit 96T 921 € DL elisas human
EKU03386 Complement Component 3a (C3a) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
EKU03387 Complement Component 3a (C3a) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
EKU03388 Complement Component 3a (C3a) ELISA kit 1 plate of 96 wells 764 € Biomatik ELISA kits human
EKU03389 Complement Component 3a (C3a) ELISA kit 1 plate of 96 wells 883 € Biomatik ELISA kits human