Recombinant Human Mesothelin, MSLN, CAK1, MPF (C-6His)

Contact us
Catalog number: CM52
Price: 322 €
Supplier: ABM lentivectors
Product name: Recombinant Human Mesothelin, MSLN, CAK1, MPF (C-6His)
Quantity: 1.0 µg DNA
Other quantities: 1 mg 1877€ 50 µg 232€ 500 µg 1328€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Mesothelin is produced by our Mammalian expression system and the target gene encoding Leu37-Arg286 is expressed with a 6His tag at the C-terminus
Molecular Weight: 27, 8 kD
UniProt number: Q13421
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LAGETGQEAAPLDGVLANPPNISSLSPRQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPERVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CAK1, MPF (C-6His), MSLN, Mesothelin
Short name: CAK1, MPF (C-6His), MSLN, Recombinant Mesothelin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CAK1, MPF (C-6His), mesothelin, sapiens Mesothelin, recombinant H
Alternative technique: rec
Alternative to gene target: Extracellular, MPF and SMRP, MSLN and IDBG-634054 and ENSBTAG00000000177 and 516237, MSLN and IDBG-8270 and ENSG00000102854 and 10232, Msln and IDBG-152832 and ENSMUSG00000063011 and 56047, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0031016 and pancreas development and biological process this GO :0031225 and anchored component of membrane and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding, mesothelin
Identity: 7371
Gene: MSLN | More about : MSLN
Long gene name: mesothelin
Synonyms: CAK1 MPF
Locus: 16p13, 3
Discovery year: 1999-11-22
GenBank acession: U40434
Entrez gene record: 10232
Pubmed identfication: 7665620 8552591
Havana BLAST/BLAT: OTTHUMG00000047992

Related Products :

CM52 Recombinant Human Mesothelin, MSLN, CAK1, MPF (C-6His) 500 µg 1328 € novo human
CM51 Recombinant Human Mesothelin, MSLN, CAK1, MPF (C-Fc) 1 mg 1877 € novo human
GENTAUR-58bb983415b08 Saccharomyces cerevisiae Serine/threonine-protein kinase CAK1 (CAK1) 100ug 2045 € MBS Recombinant Proteins human
GENTAUR-58bb98345a034 Saccharomyces cerevisiae Serine/threonine-protein kinase CAK1 (CAK1) 1000ug 2045 € MBS Recombinant Proteins human
GENTAUR-58bb98351cee8 Saccharomyces cerevisiae Serine/threonine-protein kinase CAK1 (CAK1) 100ug 2558 € MBS Recombinant Proteins human
GENTAUR-58bb983564e07 Saccharomyces cerevisiae Serine/threonine-protein kinase CAK1 (CAK1) 1000ug 2558 € MBS Recombinant Proteins human
RP-1085H Recombinant Human MSLN / Mesothelin Protein (aa 296-580, Fc Tag) 50μg 624 € adv human
RP-1083H Recombinant Human MSLN / Mesothelin Protein (Fc Tag) 50μg 624 € adv human
RP-1084H Recombinant Human MSLN / Mesothelin Protein (His Tag) 50μg 624 € adv human
abx572393 Anti-Human Mesothelin (MSLN) ELISA Kit 96 tests 789 € abbex human
DL-MSLN-Hu Human Mesothelin MSLN ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bde866caef0 Mouse Monoclonal [clone MN-1] (IgG) to Human MSLN / Mesothelin Antibody 50ug 597 € MBS mono human
GENTAUR-58bdca93decd7 Anti- Mesothelin (MSLN) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdca944f26a Anti- Mesothelin (MSLN) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcffa7484e Anti- Mesothelin (MSLN) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdcffae3aae Anti- Mesothelin (MSLN) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd187a7c55 Anti- Mesothelin (MSLN) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd2a23fe3d Anti- Mesothelin (MSLN) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd56ed83fc Anti- Mesothelin (MSLN) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd79bcf17f Anti- Mesothelin (MSLN) Antibody 100ug 575 € MBS Polyclonals human
abx570919 Anti-Mouse Mesothelin (MSLN) ELISA Kit 96 tests 804 € abbex mouse
E-EL-Ch0542 Chicken MSLN (Mesothelin) ELISA Kit 96T 568 € elabsciences chicken
EKU05913 Mesothelin (MSLN) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU05914 Mesothelin (MSLN) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
DL-MSLN-Mu Mouse Mesothelin MSLN ELISA Kit 96T 921 € DL elisas mouse
CP51 Recombinant Human Mesothelin (C-6His) 1 mg 1318 € novo human
CCP1538-10mg anti-Ac-[D-Lys2, Sar3]-MPF Antibody 10 mg 616 € acr human
CCP1538-1mg anti-Ac-[D-Lys2, Sar3]-MPF Antibody 1 mg 239 € acr human
CCP1538-5mg anti-Ac-[D-Lys2, Sar3]-MPF Antibody 5 mg 398 € acr human
LV228986 MSLN Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human