| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Flag tag at the N-terminus, Recombinant Human Brain-type Natriuretic Peptide is produced by our E, coli expression system and the target gene encoding His27-Arg102 is expressed with a 6His |
| Molecular Weight: |
11 kD |
| UniProt number: |
P16860 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MNHKVHHHHHHMDYKDDDDKHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
, Also separation of , Depending on the epitopes used human ELISA kits can be cross reactive to many other species, FLAGS are also used in the isolation of , For electrophorese protein detection rabbit polyclonals anti Flag conjugation are the most suited antibodies, Human proteins, It has been used to enrich proteins of height purity and quality to see the 3D crystal structure with x-ray, Mainly analyzed are human serum, Modern , Suitable for in vivo use in cells, This FLAG-tags have the sequence DYKDDDDK motiv, because its mild purification procedure tends not to disrupt such complexes, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, or , or , overexpressed proteins from cell lysates is done by FLAG go HIS tags, plasma, primarily , saliva, urine, , (Homo sapiens, An anti-flag tag (FLAG fusion protein) is use to detect a FLAG-tag, FLAG epitope that is a polypeptide , FLAG octapeptide, Homo sapiens sapiens), These tags are very useful to do protein purification by , affinity chromatography, humans , protein complexes , protein tag , recombinant, recombinant DNA, ssp, that can be added to a protein using , with multiple subunits |
| Conjugation: |
Flag |
| Group: |
recombinants |
| Gene target: |
BNP (N-6His, Brain Natriuretic Peptide |
| Short name: |
BNP (N-6His- ), Recombinant Brain Natriuretic Peptide |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Label: |
Flag |
| Species: |
Humans, Human |
| Alternative name: |
BNP (N-6His-Flag), sapiens Brain Natriuretic short protein sequence, recombinant H |
| Alternative technique: |
rec |