Recombinant Human Phosphoglucomutase 2, PGM2 (N-6His)

Contact us
Catalog number: CM27
Price: 2503 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Phosphoglucomutase 2, PGM2 (N-6His)
Quantity: 1000ug
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Phosphoglucomutase-2 is produced by our E, coli expression system and the target gene encoding Met1-Asp612 is expressed with a 6His tag at the N-terminus
Molecular Weight: 5 kD, 70
UniProt number: Q96G03
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM Tris,200 mM sodium chloride,pH8, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMAAPEGSGLDEDARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRFARLAATTFISQGIPVYLFSDITPTPFVPFTVSHLKLCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDKGISQAIEENLEPWPQAWDDSLIDSSPLLHNPSASINNDYFEDLKKYCFHRSVNRETKVKFVHTSVHGVGHSFVQSAFKAFDLVPPEAVPEQKDPDPEFPTVKYPNPEEGKGVLTLSFALADKTKARIVLANDPDADRLAVAEKQDSGEWRVFSGNELGALLGWWLFTSWKEKNQDRSALKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLKAIYVEYGYHITKASYFICHDQETIKKLFENLRNYDGKNNYPKACGKFEISAIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAPPGNSDPEQLKKELNELVSAIEEHFFQPQKYNLQPKAD
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PGM2 (N-6His), Phosphoglucomutase 2
Short name: PGM2 (N-6His), Recombinant Phosphoglucomutase 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PGM2 (N-6His), sapiens Phosphoglucomutase 2, recombinant H
Alternative technique: rec
Identity: 8906
Gene: PGM2 | More about : PGM2
Long gene name: phosphoglucomutase 2
Synonyms: FLJ10983
Synonyms name: phosphopentomutase
Locus: 4p14
Discovery year: 2001-06-22
GenBank acession: BC010087
Entrez gene record: 55276
Pubmed identfication: 9549096
RefSeq identity: NM_018290
Havana BLAST/BLAT: OTTHUMG00000097813

Related Products :

CM27 Recombinant Human Phosphoglucomutase 2, PGM2 (N-6His) 10 µg 156 € novo human
AE27761HU-48 ELISA test for Human Phosphoglucomutase-2 (PGM2) 1x plate of 48 wells 373 € abebio human
AE27761HU-96 Human Phosphoglucomutase-2 (PGM2) ELISA Kit 1x plate of 96 wells 612 € abebio human
LV261019 PGM2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
AR51955PU-N anti-PGM2 (1-612, His-tag) Antibody 0,5 mg 1109 € acr human
AR51955PU-S anti-PGM2 (1-612, His-tag) Antibody 0,1 mg 485 € acr human
GENTAUR-58be30b749bf2 Anti- PGM2 Antibody 100ug 658 € MBS Polyclonals human
abx928382 Anti-PGM2 siRNA 15 nmol 528 € abbex human
abx928383 Anti-PGM2 siRNA 15 nmol 528 € abbex human
GWB-MW948C PGM2 antibody 1 vial 521 € genways human
MBS416657 PGM2 Antibody 100ul 304 € MBS Polyclonals_1 human
MBS858260 PGM2 Antibody 100ug 370 € MBS Polyclonals_1 human
MBS275163 PGM2 antibody [C1C3] 100ul 426 € MBS Polyclonals_1 human
MBS274301 PGM2 antibody [N1C2] 100ul 426 € MBS Polyclonals_1 human
GWB-277A38 PGM2 Over-expression Lysate reagent 1 x 1 vial 463 € genways human
AE27765HU-48 ELISA test for Human Phosphoglucomutase-1 (PGM1) 1x plate of 48 wells 373 € abebio human
AE27756HU-48 ELISA test for Human Phosphoglucomutase-like protein 5 (PGM5) 1x plate of 48 wells 373 € abebio human
AE27765HU-96 Human Phosphoglucomutase-1 (PGM1) ELISA Kit 1x plate of 96 wells 612 € abebio human
AE27756HU-96 Human Phosphoglucomutase-like protein 5 (PGM5) ELISA Kit 1x plate of 96 wells 612 € abebio human
GENTAUR-58bdccfe98217 Anti- Phosphoglucomutase 5 (PGM5) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdccff09cdf Anti- Phosphoglucomutase 5 (PGM5) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdcdca31e98 Anti- Phosphoglucomutase 5 (PGM5) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bddad9b70ce Anti- Phosphoglucomutase 5 (PGM5) Antibody 100ug 564 € MBS Polyclonals human
GWB-51FE17 antibody to or anti-B-PHOSPHOGLUCOMUTASE (Lactococcus lacti) (Goat) antibody 1 x 1 vial 667 € genways human
GENTAUR-58bc48b3a7918 Bacillus subtilis Putative beta-phosphoglucomutase (yvdM) 100ug 1680 € MBS Recombinant Proteins human
GENTAUR-58bc48b4003b2 Bacillus subtilis Putative beta-phosphoglucomutase (yvdM) 1000ug 1680 € MBS Recombinant Proteins human
GENTAUR-58bc48b43b501 Bacillus subtilis Putative beta-phosphoglucomutase (yvdM) 100ug 2194 € MBS Recombinant Proteins human
GENTAUR-58bc48b4841b4 Bacillus subtilis Putative beta-phosphoglucomutase (yvdM) 1000ug 2194 € MBS Recombinant Proteins human
GENTAUR-58b88f07d43ba Escherichia coli Phosphoglucomutase (pgm) 100ug 2503 € MBS Recombinant Proteins human
GENTAUR-58b88f0833db8 Escherichia coli Phosphoglucomutase (pgm) 1000ug 2503 € MBS Recombinant Proteins human