Recombinant Human S100 Calcium Binding Protein B, S100B (N-6His)

Contact us
Catalog number: CM19
Price: 904 €
Supplier: DL elisas
Product name: Recombinant Human S100 Calcium Binding Protein B, S100B (N-6His)
Quantity: 96T
Other quantities: 1 mg 1877€ 50 µg 232€ 500 µg 1328€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human S100 Calcium Binding Protein B is produced by our E, coli expression system and the target gene encoding Met1-Glu92 is expressed with a 6His tag at the N-terminus
Molecular Weight: 12, 2 kD
UniProt number: P04271
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MNHKVHHHHHHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHEC
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: S100B (N-6His), S100 Calcium Binding Protein B
Short name: S100B (N-6His), Recombinant S100 Calcium Binding Protein B
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: S100B (N-6His), sapiens S100 Calcium Binding Protein B, recombinant H
Alternative technique: rec
Identity: 10500
Gene: S100B | More about : S100B
Long gene name: S100 calcium binding protein B
Synonyms gene name: S100 calcium binding protein, beta (neural)
Synonyms: S100beta
Locus: 21q22, 3
Discovery year: 1988-06-27
GenBank acession: M59488
Entrez gene record: 6285
Pubmed identfication: 2394738 1998503
RefSeq identity: NM_006272
Classification: S100 calcium binding proteins EF-hand domain containing
Havana BLAST/BLAT: OTTHUMG00000090715

Related Products :

MBS613298 CABP9K (CALB3, CABP1, S100G, S100 calcium binding protein G, CABP, Calbindin-D9k, MGC138379, Protein S100-G, S100 calcium-binding protein G, S100D, Vitamin D-dependent calcium-binding protein, intestinal) Antibody 0.05 ml 442 € MBS Polyclonals_1 human
CM19 Recombinant Human S100 Calcium Binding Protein B, S100B (N-6His) 50 µg 232 € novo human
CK82 Recombinant Mouse S100 Calcium Binding Protein B, S100B (C-6His) 500 µg 1613 € novo mouse
C258 Recombinant Human S100 Calcium Binding Protein P, S100-P (N-6His) 50 µg 496 € novo human
AP50043HU-100ug Human S100 Calcium Binding Protein B (S100B) 0.1mg 184 € abebio human
AP50043HU-1mg Human S100 Calcium Binding Protein B (S100B) 1mg 604 € abebio human
DL-S100B-Hu Human S100 Calcium Binding Protein B S100B ELISA Kit 96T 846 € DL elisas human
AP50043HU Human S100 Calcium Binding B (S100B) 5ug 523 € AbELISA Rec human
GENTAUR-58bdc5ec5d0dd Anti- S100 Calcium Binding Protein B (S100B) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc5ecc4fc5 Anti- S100 Calcium Binding Protein B (S100B) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc861196dc Anti- S100 Calcium Binding Protein B (S100B) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdc964c67dc Anti- S100 Calcium Binding Protein B (S100B) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdc965440a0 Anti- S100 Calcium Binding Protein B (S100B) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdc9bd9874f Anti- S100 Calcium Binding Protein B (S100B) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdca1c51923 Anti- S100 Calcium Binding Protein B (S100B) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdcd54d5aa8 Anti- S100 Calcium Binding Protein B (S100B) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdceb121d3a Anti- S100 Calcium Binding Protein B (S100B) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdceb186b85 Anti- S100 Calcium Binding Protein B (S100B) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdd08b376cc Anti- S100 Calcium Binding Protein B (S100B) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdd08b8db28 Anti- S100 Calcium Binding Protein B (S100B) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdd0ae660d2 Anti- S100 Calcium Binding Protein B (S100B) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdd0aed608b Anti- S100 Calcium Binding Protein B (S100B) Antibody 100ug 448 € MBS Polyclonals human
GENTAUR-58bdd30e3a6e2 Anti- S100 Calcium Binding Protein B (S100B) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdd63211989 Anti- S100 Calcium Binding Protein B (S100B) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddaf2e2d47 Anti- S100 Calcium Binding Protein B (S100B) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bddc12195ab Anti- S100 Calcium Binding Protein B (S100B) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddc6732a9f Anti- S100 Calcium Binding Protein B (S100B) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bddcf820e8b Anti- S100 Calcium Binding Protein B (S100B) Antibody 100ug 531 € MBS Polyclonals human
DL-S100B-Mu Mouse S100 Calcium Binding Protein B S100B ELISA Kit 96T 869 € DL elisas mouse
DL-S100B-Rb Rabbit S100 Calcium Binding Protein B S100B ELISA Kit 96T 904 € DL elisas human