Recombinant Mouse Interferon α-2

Contact us
Catalog number: CK83
Price: 238 €
Supplier: abbex
Product name: Recombinant Mouse Interferon α-2
Quantity: 2 µg
Other quantities: 1 mg 1014€ 10 µg 80€ 50 µg 141€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Interferon alpha-2 is produced by our E, coli expression system and the target gene encoding Cys24-Glu190 is expressed
Molecular Weight: 19, 5 kD
UniProt number: P01573
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 100 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MCDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: -2, Interferon &alpha
Short name: -2, Recombinant Mouse Interferon &alpha
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses
Alternative name: -2, recombinant Mouse Interferon &alpha
Alternative technique: rec

Related Products :

MBS610191 Fragilis (1 8U, Ifitm3, Interferon Induced Transmembrane Protein 3, Interferon inducible protein 1 8U, Interferon Inducible Protein 15, Interferon Inducible Protein Homolog) Antibody 100ug 558 € MBS Polyclonals_1 human
MBS612461 Interferon Stimulating Gene 15 (ISG15, 15kD Ubiquitin-like Modifier GIP2, G1P2, Interferon Induced 15kD Protein, IFI15, Interferon alpha Inducible Protein, Interferon Stimulated Protein 15kD, Ubiquitin Cross-reactive Protein, UCRP) Antibody 500ug 829 € MBS Polyclonals_1 human
MBS614704 Interferon alpha-Inducible Protein 27 (IFI27, 2310061N23Rik, FAM14D, Interferon alpha-Induced 11.5kD Protein, ISG12, ISG12(a) Protein, P27) Antibody 100ug 785 € MBS Polyclonals_1 human
MBS616766 CXCL11 (Chemokine (C-X-C Motif) Ligand 11, b R1, H174, Interferon-inducible T Cell Alpha Chemoattractant, I-TAC, Interferon gamma Inducible Protein 9, IP-9, MGC102770, Small Inducible Cytokine B11, SCYB11, SCYB9B) Antibody 50ug 625 € MBS Polyclonals_1 human
MBS619394 Spectrin, alpha (Spectrin alpha Chain, Spectrin alpha Chain Brain, Spectrin Non-erythroid alpha Chain, Alpha Fodrin, Alpha II Spectrin, FLJ44613, Fodrin alpha Chain, Non-erythrocytic Spectrin alpha, Spectrin alpha Non-erythrocytic 1, SPTAN1, SPTA2) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS620094 T-Complex Protein 1 alpha (T Complex Protein 1 alpha Subunit, T Complex Protein 1 Subunit alpha, TCP1 alpha, TCP1-alpha, TCP-1 alpha, CCT 1, CCT1, CCT alpha, CCTa, D6S230E, T Complex 1, T-complex 1, T Complex Locus TCP1, T-complex Locus TCP-1, T Complex P 100ug 735 € MBS Polyclonals_1 human
MBS622864 Tubulin, alpha, Detyrosinated (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) Antibody 50ug 1089 € MBS Polyclonals_1 human
MBS623932 ISG15, CT (Interferon-induced 17kD Protein, Ubiquitin Cross-reactive Protein, hUCRP, Interferon-induced 15kD Protein,G1P2, UCRP, Ubiquitin-like Protein ISG15, IP17) Antibody 200ul 603 € MBS Polyclonals_1 human
YM5058 Interferon alpha 2b, NO X w/IFN beta or gamma, Clone: IFNA2.3, Mouse Monoclonal antibody-Human recombinant; Neutralizes/ELISA (coating)/IP 0.1mg Ask price € accurate-monoclonals human
GWB-125FF6 Interferon Alpha 4 (recombinant) Mouse 1 x 1 vial 971 € genways mouse
GWB-E8E1CE Interferon Alpha A (recombinant) Mouse 1 vial 845 € genways mouse
YM5092 Interferon alpha IIb (INFαIIb), natural & recombinant, NO X w/IFN b or g, Clone: IFNA2.4, Mouse Monoclonal antibody-Human; EIA/IP 0.1mg 982 € accurate-monoclonals human
CK83 Recombinant Mouse Interferon α-2 50 µg 141 € novo human
MBS621862 SRD5A1 (Steroid 5-alpha-reductase 1, Steroid 5-alpha-reductase alpha Polypeptide 1 (3-oxo-5-alpha-steroid delta 4-dehydrogenase alpha 1), Steroid 5-alpha-reductase alpha Polypeptide 1, SRD5A-1, 3-oxo-5-alpha-steroid 4-dehydrogenase 1, 3-oxo-5-alpha-steroi Antibody 100ug 641 € MBS Polyclonals_1 human
YD21380 Interferon alpha/beta Receptor Chain 1 (alpha chain), Clone: MMHAR-1, Mouse Monoclonal antibody-Human 50 ug Ask price € accurate-monoclonals human
OBT4854 Interferon Alpha, Clone: F18, Rat Mouse Monoclonal antibody-Mouse; neutralization 200ug Ask price € accurate-monoclonals mouse
OBT4854Z Interferon Alpha, Clone: F18, Rat Mouse Monoclonal antibody-Mouse; neutralization, azide free 1 mg Ask price € accurate-monoclonals mouse
YD22100 Interferon alpha (IFNα), Clone: RMMA-1, Rat Mouse Monoclonal antibody-Mouse 0.25mg 1126 € accurate-monoclonals human
abx261751 Anti-Interferon alpha 1 Protein (Recombinant) 5 µg 238 € abbex human
abx168458 Anti-Interferon alpha 11 Protein (Recombinant) 100 μg 920 € abbex human
abx260707 Anti-Interferon alpha 14 Protein (Recombinant) 20 µg 340 € abbex human
abx263104 Anti-Interferon alpha 1a Protein (Recombinant) 100 µg 340 € abbex human
abx263103 Anti-Interferon alpha 1b Protein (Recombinant) 1 mg 1297 € abbex human
abx168294 Anti-Interferon alpha 2 Protein (Recombinant) 50 μg 659 € abbex human
abx168560 Anti-Interferon alpha 2 Protein (Recombinant) 10 μg 427 € abbex human
abx263189 Anti-Interferon alpha 2a, HEK Protein (Recombinant) 100 µg 1543 € abbex human
abx263101 Anti-Interferon alpha 2a Protein (Recombinant) 1 mg 1297 € abbex human
abx261753 Anti-Interferon alpha 2a, Tobacco Protein (Recombinant) 25 µg 340 € abbex human
abx262364 Anti-Interferon alpha 2b 20kd-Pegylated Protein (Recombinant) 1 mg 6662 € abbex human
abx263188 Anti-Interferon alpha 2b, HEK Protein (Recombinant) 2 µg 238 € abbex human