Recombinant Human Epidermal Growth Factor Receptor (V30G, Del31-297), ErbB1, HER1 (C-6His)

Contact us
Catalog number: CK75
Price: 685 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Human Epidermal Growth Factor Receptor (V30G, Del31-297), ErbB1, HER1 (C-6His)
Quantity: 1 plate of 96 wells
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Asn298-Ser645 is expressed with a 6His tag at the C-terminus, Recombinant Human EGFR is produced by our Mammalian expression system and the target gene encoding Leu25-Val30Gly&
Molecular Weight: 39, 7 kD
UniProt number: P00533
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Del31-297) ErbB1, HER1 (C-6His), Epidermal Growth Factor Receptor (V30G
Short name: Del31-297) ErbB1, HER1 (C-6His), Recombinant Epidermal Growth Factor Receptor (V30G
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Del31-297), ErbB1, HER1 (C-6His), sapiens Epidermal Growth Factor Receptor (V30G, recombinant H
Alternative technique: rec

Related Products :

CK75 Recombinant Human Epidermal Growth Factor Receptor (V30G, Del31-297), ErbB1, HER1 (C-6His) 10 µg 156 € novo human
CK80 Recombinant Human Epidermal Growth Factor Receptor (V30G, Del31-297), ErbB1, HER1 (C-Fc) 50 µg 369 € novo human
CI61 Recombinant Human Epidermal Growth Factor Receptor, EGFR, ErbB1, HER1 (C-6His) 1 mg 2486 € novo human
CI54 Recombinant Human Epidermal Growth Factor Receptor, EGFR, ErbB1, HER1 (C-Fc) 1 mg 2283 € novo human
MBS621693 CD312 (EMR2, Epidermal Growth Factor-Like Module-Containing Mucin-Like Receptor 2, Epidermal Growth Factor Seven Transmembrane, EGF-TM7) (Biotin) Antibody 50ug 818 € MBS Polyclonals_1 human
RP-0599H Recombinant Human EGFR / HER1 / ErbB1 (aa 668-1210) Protein (His & GST Tag) 20μg 659 € adv human
RP-0598H Recombinant Human EGFR / HER1 / ErbB1 Protein (Fc Tag) 50μg 624 € adv human
RP-0597H Recombinant Human EGFR / HER1 / ErbB1 Protein (His Tag) 50μg 624 € adv human
RP-1248M Recombinant Mouse EGFR / HER1 / ErbB1 Protein (Fc Tag) 50μg 624 € adv mouse
RP-1249M Recombinant Mouse EGFR / HER1 / ErbB1 Protein (His Tag) 50μg 624 € adv mouse
RP-2117R Recombinant Rat EGFR / HER1 / ErbB1 Protein (His Tag) 50μg 624 € adv rat
RP-742 Recombinant (E.Coli, GST tag) Human Epidermal Growth Factor Receptor (ErbB1), Active 2 μg 405 € adi human
RP-741 Recombinant (E.Coli, strep tag) Human Epidermal Growth Factor Receptor-Sf9 (ErbB1) 1 μg 333 € adi human
RP-749 Recombinant Human Epidermal Growth Factor Receptor-Sf9 (ErbB1) strep tag 2 μg 188 € adi human
MBS624173 EGFR, phosphorylated (Tyr1172) (Epidermal Growth Factor Receptor, Receptor Tyrosine-protein Kinase ErbB-1, Proto-oncogene c-ErbB-1, ERBB1) Antibody 200ul 597 € MBS Polyclonals_1 human
MBS624534 EGFR, phosphorylated (Tyr1197) (Epidermal Growth Factor Receptor, Proto-oncogene c-ErbB-1, Receptor Tyrosine-protein Kinase erbB-1, ERBB1) Antibody 50ug 481 € MBS Polyclonals_1 human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
MBS624351 CRIPTO, CT (Teratocarcinoma-derived Growth Factor 1, Epidermal Growth Factor-like Cripto Protein CR1, Cripto-1 Growth Factor, CRGF, TDGF1) Antibody 200ul 597 € MBS Polyclonals_1 human
MBS623911 GRB7 (Growth Factor Receptor-bound Protein 7, B47, Epidermal Growth Factor Receptor GRB-7, GRB7 Adapter Protein) Antibody 100ug 658 € MBS Polyclonals_1 human
CH28 Recombinant Mouse Epidermal Growth Factor, EGF (C-6His) 1 mg 1014 € novo mouse
DL-HBEGF-Hu Human Heparin Binding Epidermal Growth Factor Like Growth Factor HBEGF ELISA Kit 96T 672 € DL elisas human
MBS612244 Nerve Growth Factor Receptor, p75 (NGFR, NGF Receptor, CD271, Gp80 LNGFR, Low Affinity Nerve Growth Factor Receptor, Low Affinity Neurotrophin Receptor p75 NTR, p75 ICD, p75 Neurotrophin, p75 NTR, Tumor Necrosis Factor Receptor Superfamily Member 16, TNFR Antibody 100ug 591 € MBS Polyclonals_1 human
GENTAUR-58bdc55d793c1 Anti- Heparin Binding Epidermal Growth Factor Like Growth Factor (HBEGF) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdc5d0bf9bc Anti- Heparin Binding Epidermal Growth Factor Like Growth Factor (HBEGF) Antibody 50ug 332 € MBS Polyclonals human
GENTAUR-58bdc5d12dac3 Anti- Heparin Binding Epidermal Growth Factor Like Growth Factor (HBEGF) Antibody 100ug 409 € MBS Polyclonals human
GENTAUR-58bdd677d7934 Anti- Heparin Binding Epidermal Growth Factor Like Growth Factor (HBEGF) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58be31b567a1f Cripto-1 (Epidermal Growth Factor-Like Cripto Protein CR1, TDGF-1, Teratocarcinoma-Derived Growth Factor 1, CFC-2) 500ug 730 € MBS mono human
GENTAUR-58be31b4d4223 Cripto-1 (Epidermal Growth Factor-Like Cripto Protein CR1, TDGF-1, Teratocarcinoma-Derived Growth Factor 1, CFC-2) Antibody 500ug 730 € MBS mono human
EKU04740 Heparin Binding Epidermal Growth Factor Like Growth Factor (HBEGF) ELISA kit 1 plate of 96 wells 667 € Biomatik ELISA kits human
EKU04741 Heparin Binding Epidermal Growth Factor Like Growth Factor (HBEGF) ELISA kit 1 plate of 96 wells 685 € Biomatik ELISA kits human