| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Receptor agonists are often tested for drug development, FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling |
| Molecular Weight: |
4 kD, 49 |
| UniProt number: |
Q9BZM6 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
NKG2DL, ULBP1 (C-Fc), NKG2D Ligand 1 |
| Short name: |
NKG2DL, ULBP1 (C-Fc), Recombinant NKG2D Ligand 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
NKG2DL, UL16 binding protein 1 (C-fragment c), sapiens NKG2D Ligand 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Plasma membranes, ULBP1 and IDBG-97845 and ENSG00000111981 and 80329, natural killer cell lectin-like receptor binding, this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0019882 and antigen processing and presentation and biological process this GO :0030101 and natural killer cell activation and biological process this GO :0042267 and natural killer cell mediated cytotoxicity and biological process this GO :0046658 and anchored component of plasma membrane and cellular component this GO :0046703 and natural killer cell lectin-like receptor binding and molecular function this GO :0050776 and regulation of immune response and biological process, this GO :0046703 : natural killer cell lectin-like receptor binding, this GO :0046703 : natural killer cell lectin-like receptor binding, UL16 binding protein 1 |
| Identity: |
14893 |
| Gene: |
ULBP1 |
More about : ULBP1 |
| Long gene name: |
UL16 binding protein 1 |
| Synonyms: |
RAET1I |
| Locus: |
6q25, 1 |
| Discovery year: |
2001-04-27 |
| GenBank acession: |
AF304377 |
| Entrez gene record: |
80329 |
| Pubmed identfication: |
11239445 11827464 |
| Havana BLAST/BLAT: |
OTTHUMG00000015810 |