Recombinant Human Bone Morphogenetic Protein 9, BMP-9, GDF-2 (C-6His)

Contact us
Catalog number: CK38
Price: 497 €
Supplier: elabsciences
Product name: Recombinant Human Bone Morphogenetic Protein 9, BMP-9, GDF-2 (C-6His)
Quantity: 96T
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Growth and differentiation factor 2 is produced by our Mammalian expression system and the target gene encoding Ser320-Arg429 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 12
UniProt number: Q9UK05
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 4 mM HCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: BMP-9, GDF-2 (C-6His), Bone Morphogenetic Protein 9
Short name: BMP-9, GDF-2 (C-6His), Recombinant Bone Morphogenetic Protein 9
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: BMP-9, GDF-2 (C-6His), sapiens Bone Morphogenetic Protein 9, recombinant H
Alternative technique: rec
Identity: 4217
Gene: GDF2 | More about : GDF2
Long gene name: growth differentiation factor 2
Synonyms: BMP-9 BMP9
Locus: 10q11, 22
Discovery year: 1997-09-12
GenBank acession: AF156891
Entrez gene record: 2658
Pubmed identfication: 10849432
RefSeq identity: NM_016204
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000188320

Related Products :

MBS624210 Bmp3, NT (Bone Morphogenetic Protein 3, BMP-3, Bone Morphogenetic Protein 3A, BMP-3A, BMP3A, Osteogenin) Antibody 200ul 603 € MBS Polyclonals_1 human
CK38 Recombinant Human Bone Morphogenetic Protein 9, BMP-9, GDF-2 (C-6His) 10 µg 202 € novo human
MBS611501 Bone Morphogenic Protein 14 (BMP14, CDMP1, Cartilage-Derived Morphogenetic Protein-1, GDF-5) Antibody 0.05 ml 475 € MBS Polyclonals_1 human
C012 Recombinant Human Bone Morphogenetic Protein 2, BMP-2 10 µg 202 € novo human
RP-1783H Recombinant Human Bone Morphogenetic Protein-2 (BMP-2) 50ug 514 € adv human
BMP12-P Human Bone Morphogenetic protein 1 (BMP-1) Control/blocking peptide # 2 100 μg 188 € adi human
MBS620831 Bone Morphogenetic Protein 2 Inducible Kinase (BMP-2 Inducible Protein Kinase, BMP2 Inducible Kinase, BMP2 Inducible Protein Kinase, BIKE, BMP2K, DKFZp434K0614, DKFZp434P0116, HRIHFB2017) Antibody 50ug 768 € MBS Polyclonals_1 human
BMP131-C Human recombinant, purified BMP-13 (CDMP-2/GDF-6) protein control for WB 100 μL 333 € adi human
BMP141-C Human recombinant, purified BMP-14 (CDMP-1/GDF-5) protein control for WB 100 μL 333 € adi human
BMP135-R-10 Purified Recombinant Human BMP-13 (CDMP-2/GDF-6), Biologically active, Carrier free 10 μg 478 € adi human
BMP135-R-50 Purified Recombinant Human BMP-13 (CDMP-2/GDF-6), Biologically active, Carrier free 50 μg 1058 € adi human
BMP145-R-10 Purified Recombinant Human BMP-14 (CDMP-1/GDF-5), Biologically active, Carrier free 10 μg 478 € adi human
BMP145-R-50 Purified Recombinant Human BMP-14 (CDMP-1/GDF-5), Biologically active, Carrier free 50 μg 1058 € adi human
GWB-BIG096 Recombinant Human GDF-5 (BMP-14/CDMP-1) bulk Ask price € genways bulk human
C799 Recombinant Human Growth Dfferentiation Factor 11, GDF-11, BMP-11 50 µg 496 € novo human
GWB-CD5509 antibody to or anti- Bone Morphogenetic protein-2/4 (BMP-2/4) antibody 1 vial 1630 € genways human
GWB-F86FD6 antibody to or anti- Bone Morphogenetic protein-2 (BMP-2) antibody 1 vial 845 € genways human
MBS540230 Bone morphogenetic protein 1 (BMP 1) Antibody 200ul FITC 597 € MBS Polyclonals_1 human
GWB-3E4BB9 Bone Morphogenetic protein-2 (BMP-2) 1 x 1 vial 579 € genways human
GWB-479CFC Bone Morphogenetic protein-2 (BMP-2) 1 x 1 vial 1041 € genways human
GWB-BCC154 Bone Morphogenetic protein-2 (BMP-2) 1 vial 11158 € genways human
MBS540512 Bone morphogenetic protein 2 (BMP 2) Antibody 200ul Biotin 597 € MBS Polyclonals_1 human
GWB-2FEE2E Bone Morphogenetic protein 4 (BMP-4), antibody 1 x 1 vial 1225 € genways human
MBS540007 Bone morphogenetic protein 4 (BMP 4) Antibody 200ul Affinity Purified 453 € MBS Polyclonals_1 human
MBS540008 Bone morphogenetic protein 8 (BMP 8) Antibody 200ul Affinity Purified 453 € MBS Polyclonals_1 human
MBS540569 Bone morphogenetic protein comb. (BMP-com) Antibody 200ul Biotin 586 € MBS Polyclonals_1 human
E-EL-C0046 Canine BMP-4 (Bone Morphogenetic Protein 4) ELISA Kit 96T 624 € elabsciences human
E-EL-Ch0580 Chicken BMP-10 (Bone Morphogenetic Protein 10) ELISA Kit 96T 497 € elabsciences chicken
E-EL-Ch0434 Chicken BMP-15 (Bone Morphogenetic Protein 15) ELISA Kit 96T 497 € elabsciences chicken
E-EL-Ch0593 Chicken BMP-2 (Bone Morphogenetic Protein 2) ELISA Kit 96T 497 € elabsciences chicken