| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Transforming Growth Factor beta 2 is produced by our Mammalian expression system and the target gene encoding Ala303-Ser414 is expressed |
| Molecular Weight: |
12, 7 kD |
| UniProt number: |
P27090 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of 4 mM HCl, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
TGF&beta, TGFB2, -2, 2, Transforming Growth Factor &beta |
| Short name: |
TGF&beta, TGFB2, -2, 2, Recombinant Mouse Transforming Growth Factor &beta |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses |
| Alternative name: |
TGF&beta, b 2, transforming growth factor, -2, 2, recombinant Mouse Transforming Growth Factor &beta |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, LDS4 and TGF-beta2, TGFB2 and IDBG-106710 and ENSG00000092969 and 7042, TGFB2 and IDBG-629908 and ENSBTAG00000005359 and 534069, Tgfb2 and IDBG-208111 and ENSMUSG00000039239 and 21808, beta 2, protein heterodimerization activity, this GO :0000902 and cell morphogenesis and biological process this GO :0001501 and skeletal system development and biological process this GO :0001502 and cartilage condensation and biological process this GO :0001525 and angiogenesis and biological process this GO :0001540 and beta-amyloid binding and molecular function this GO :0001568 and blood vessel development and biological process this GO :0001654 and eye development and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001837 and epithelial to mesenchymal transition and biological process this GO :0001942 and hair follicle development and biological process this GO :0001974 and blood vessel remodeling and biological process this GO :0002576 and platelet degranulation and biological process this GO :0003007 and heart morphogenesis and biological process this GO :0004702 and receptor signaling protein serine/threonine kinase activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005114 and type II transforming growth factor beta receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005160 and transforming growth factor beta receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005768 and endosome and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007184 and SMAD protein import into nucleus and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007411 and axon guidance and biological process this GO :0007435 and salivary gland morphogenesis and biological process this GO :0007507 and heart development and biological process this GO :0007596 and blood coagulation and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008219 and cell death and biological process this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008347 and glial cell migration and biological process this GO :0009611 and response to wounding and biological process this GO :0009790 and embryo development and biological process this GO :0010002 and cardioblast differentiation and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010634 and positive regulation of epithelial cell migration and biological process this GO :0010693 and negative regulation of alkaline phosphatase activity and biological process this GO :0010718 and positive regulation of epithelial to mesenchymal transition and biological process this GO :0010936 and negative regulation of macrophage cytokine production and biological process this GO :0014068 and positive regulation of phosphatidylinositol 3-kinase signaling and biological process this GO :0016049 and cell growth and biological process this GO :0016477 and cell migration and biological process this GO :0022601 and menstrual cycle phase and biological process this GO :0023014 and signal transduction by phosphorylation and biological process this GO :0030097 and hemopoiesis and biological process this GO :0030168 and platelet activation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030199 and collagen fibril organization and biological process this GO :0030307 and positive regulation of cell growth and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030424 and axon and cellular component this GO :0030593 and neutrophil chemotaxis and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0031069 and hair follicle morphogenesis and biological process this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0032147 and activation of protein kinase activity and biological process this GO :0032570 and response to progesterone and biological process this GO :0032874 and positive regulation of stress-activated MAPK cascade and biological process this GO :0032909 and regulation of transforming growth factor beta2 production and biological process this GO :0033630 and positive regulation of cell adhesion mediated by integrin and biological process this GO :0040007 and growth and biological process this GO :0042060 and wound healing and biological process this GO :0042416 and dopamine biosynthetic process and biological process this GO :0042476 and odontogenesis and biological process this GO :0042493 and response to drug and biological process this GO :0042637 and catagen and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043525 and positive regulation of neuron apoptotic process and biological process this GO :0045216 and cell-cell junction organization and biological process this GO :0045726 and positive regulation of integrin biosynthetic process and biological process this GO :0045778 and positive regulation of ossification and biological process this GO :0045787 and positive regulation of cell cycle and biological process this GO :0045823 and positive regulation of heart contraction and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048103 and somatic stem cell division and biological process this GO :0048566 and embryonic digestive tract development and biological process this GO :0048663 and neuron fate commitment and biological process this GO :0048666 and neuron development and biological process this GO :0048699 and generation of neurons and biological process this GO :0050680 and negative regulation of epithelial cell proliferation and biological process this GO :0050714 and positive regulation of protein secretion and biological process this GO :0050777 and negative regulation of immune response and biological process this GO :0050778 and positive regulation of immune response and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :0051795 and positive regulation of catagen and biological process this GO :0051891 and positive regulation of cardioblast differentiation and biological process this GO :0060038 and cardiac muscle cell proliferation and biological process this GO :0060317 and cardiac epithelial to mesenchymal transition and biological process this GO :0060325 and face morphogenesis and biological process this GO :0060389 and pathway-restricted SMAD protein phosphorylation and biological process this GO :0070237 and positive regulation of activation-induced cell death of T cells and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :2001241 and positive regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0001540 : beta-amyloid binding, this GO :0001540 : beta-amyloid binding and also this GO :0004702 : receptor signaling protein serine/threonine kinase activity and also this GO :0005102 : receptor binding and also this GO :0005114 : type II transforming growth factor beta receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005160 : transforming growth factor beta receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0042803 : protein homodimerization activity and also this GO :0046982 : protein heterodimerization activity, this GO :0004702 : receptor signaling protein serine/threonine kinase activity, this GO :0005102 : receptor binding, this GO :0005114 : type II transforming growth factor beta receptor binding, this GO :0005125 : cytokine activity, this GO :0005160 : transforming growth factor beta receptor binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0042803 : protein homodimerization activity, this GO :0046982 : protein heterodimerization activity, transforming growth factor |
| Identity: |
11768 |
| Gene: |
TGFB2 |
More about : TGFB2 |
| Long gene name: |
transforming growth factor beta 2 |
| Synonyms gene name: |
beta 2 , transforming growth factor |
| Synonyms name: |
prepro-transforming growth factor beta-2 |
| Locus: |
1q41 |
| Discovery year: |
1989-05-10 |
| GenBank acession: |
M19154 |
| Entrez gene record: |
7042 |
| RefSeq identity: |
NM_003238 |
| Classification: |
Endogenous ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000039521 |