| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Apolipoprotein A-I is produced by our E, coli expression system and the target gene encoding Arg19-Gln267 is expressed |
| Molecular Weight: |
28, 96 kD |
| UniProt number: |
P02647 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
APOA1, Apolipoprotein A-I |
| Short name: |
APOA1, Recombinant Apolipoprotein A-I |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
apolipoprotein A-I, sapiens Apolipoprotein A-I, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
APOA1 and IDBG-630796 and ENSBTAG00000002258 and 281631, APOA1 and IDBG-72644 and ENSG00000118137 and 335, Apoa1 and IDBG-161189 and ENSMUSG00000032083 and 11806, lipoprotein particle binding, nuclei, this GO :0001523 and retinoid metabolic process and biological process this GO :0001540 and beta-amyloid binding and molecular function this GO :0001932 and regulation of protein phosphorylation and biological process this GO :0001935 and endothelial cell proliferation and biological process this GO :0002576 and platelet degranulation and biological process this GO :0002740 and negative regulation of cytokine secretion involved in immune response and biological process this GO :0005319 and lipid transporter activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005543 and phospholipid binding and molecular function this GO :0005548 and phospholipid transporter activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005769 and early endosome and cellular component this GO :0005788 and endoplasmic reticulum lumen and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006644 and phospholipid metabolic process and biological process this GO :0006656 and phosphatidylcholine biosynthetic process and biological process this GO :0006695 and cholesterol biosynthetic process and biological process this GO :0006869 and lipid transport and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007584 and response to nutrient and biological process this GO :0007596 and blood coagulation and biological process this GO :0007603 and phototransduction, this GO :0001540 : beta-amyloid binding, this GO :0001540 : beta-amyloid binding and also this GO :0005319 : lipid transporter activity and also this GO :0005515 : protein binding and also this GO :0005543 : phospholipid binding and also this GO :0005548 : phospholipid transporter activity and also this GO :0008035 : high-density lipoprotein particle binding and also this GO :0008289 : lipid binding and also this GO :0015485 : cholesterol binding and also this GO :0017127 : cholesterol transporter activity and also this GO :0019899 : enzyme binding and also this GO :0034190 : apolipoprotein receptor binding and also this GO :0034191 : apolipoprotein A-I receptor binding and also this GO :0042802 : identical protein binding and also this GO :0055102 : lipase inhibitor activity and also this GO :0060228 : phosphatidylcholine-sterol O-acyltransferase activator activity and also this GO :0070653 : high-density lipoprotein particle receptor binding and also this GO :0071813 : lipoprotein particle binding, this GO :0005319 : lipid transporter activity, this GO :0005515 : protein binding, this GO :0005543 : phospholipid binding, this GO :0005548 : phospholipid transporter activity, this GO :0008035 : high-density lipoprotein particle binding, this GO :0008289 : lipid binding, this GO :0015485 : cholesterol binding, this GO :0017127 : cholesterol transporter activity, this GO :0019899 : enzyme binding, this GO :0034190 : apolipoprotein receptor binding, this GO :0034191 : apolipoprotein A-I receptor binding, this GO :0042802 : identical protein binding, this GO :0055102 : lipase inhibitor activity, this GO :0060228 : phosphatidylcholine-sterol O-acyltransferase activator activity, this GO :0070653 : high-density lipoprotein particle receptor binding, this GO :0071813 : lipoprotein particle binding, visible light and biological process this GO :0008035 and high-density lipoprotein particle binding and molecular function this GO :0008203 and cholesterol metabolic process and biological process this GO :0008211 and glucocorticoid metabolic process and biological process this GO :0008289 and lipid binding and molecular function this GO :0009986 and cell surface and cellular component this GO :0010804 and negative regulation of tumor necrosis factor-mediated signaling pathway and biological process this GO :0010873 and positive regulation of cholesterol esterification and biological process this GO :0010903 and negative regulation of very-low-density lipoprotein particle remodeling and biological process this GO :0014012 and peripheral nervous system axon regeneration and biological process this GO :0015485 and cholesterol binding and molecular function this GO :0015914 and phospholipid transport and biological process this GO :0017127 and cholesterol transporter activity and molecular function this GO :0018158 and protein oxidation and biological process this GO :0018206 and peptidyl-methionine modification and biological process this GO :0019899 and enzyme binding and molecular function this GO :0019915 and lipid storage and biological process this GO :0030139 and endocytic vesicle and cellular component this GO :0030168 and platelet activation and biological process this GO :0030300 and regulation of intestinal cholesterol absorption and biological process this GO :0030301 and cholesterol transport and biological process this GO :0030325 and adrenal gland development and biological process this GO :0031100 and organ regeneration and biological process this GO :0031410 and cytoplasmic vesicle and cellular component this GO :0032489 and regulation of Cdc42 protein signal transduction and biological process this GO :0033344 and cholesterol efflux and biological process this GO :0033700 and phospholipid efflux and biological process this GO :0034115 and negative regulation of heterotypic cell-cell adhesion and biological process this GO :0034190 and apolipoprotein receptor binding and molecular function this GO :0034191 and apolipoprotein A-I receptor binding and molecular function this GO :0034361 and very-low-density lipoprotein particle and cellular component this GO :0034364 and high-density lipoprotein particle and cellular component this GO :0034365 and discoidal high-density lipoprotein particle and cellular component this GO :0034366 and spherical high-density lipoprotein particle and cellular component this GO :0034375 and high-density lipoprotein particle remodeling and biological process this GO :0034380 and high-density lipoprotein particle assembly and biological process this GO :0034384 and high-density lipoprotein particle clearance and biological process this GO :0034774 and secretory granule lumen and cellular component this GO :0042157 and lipoprotein metabolic process and biological process this GO :0042158 and lipoprotein biosynthetic process and biological process this GO :0042493 and response to drug and biological process this GO :0042632 and cholesterol homeostasis and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043534 and blood vessel endothelial cell migration and biological process this GO :0043627 and response to estrogen and biological process this GO :0043691 and reverse cholesterol transport and biological process this GO :0044255 and cellular lipid metabolic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045087 and innate immune response and biological process this GO :0050713 and negative regulation of interleukin-1 beta secretion and biological process this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0050821 and protein stabilization and biological process this GO :0051345 and positive regulation of hydrolase activity and biological process this GO :0051346 and negative regulation of hydrolase activity and biological process this GO :0051347 and positive regulation of transferase activity and biological process this GO :0055085 and transmembrane transport and biological process this GO :0055091 and phospholipid homeostasis and biological process this GO :0055102 and lipase inhibitor activity and molecular function this GO :0060192 and negative regulation of lipase activity and biological process this GO :0060228 and phosphatidylcholine-sterol O-acyltransferase activator activity and molecular function this GO :0060354 and negative regulation of cell adhesion molecule production and biological process this GO :0060761 and negative regulation of response to cytokine stimulus and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070328 and triglyceride homeostasis and biological process this GO :0070508 and cholesterol import and biological process this GO :0070653 and high-density lipoprotein particle receptor binding and molecular function this GO :0071682 and endocytic vesicle lumen and cellular component this GO :0071813 and lipoprotein particle binding and molecular function this GO :0072562 and blood microparticle and cellular component, apolipoprotein A-I |
| Identity: |
600 |
| Gene: |
APOA1 |
More about : APOA1 |
| Long gene name: |
apolipoprotein A1 |
| Synonyms gene name: |
apolipoprotein A-I |
| Locus: |
11q23, 3 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
X02162 |
| Entrez gene record: |
335 |
| RefSeq identity: |
NM_000039 |
| Classification: |
Apolipoproteins |
| Havana BLAST/BLAT: |
OTTHUMG00000046112 |
| Locus Specific Databases: |
LRG_767 |