| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Thymic stromal lymphopoietin is produced by our E, coli expression system and the target gene encoding Tyr29-Gln159 is expressed |
| Molecular Weight: |
1 kD, 15 |
| UniProt number: |
Q969D9 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
TSLP, Thymic Stromal Lymphopoietin |
| Short name: |
TSLP, Recombinant Thymic Stromal Lymphopoietin |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
sapiens Thymic Stromal Lymphopoietin, thymic stromal lymphopoietin, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, TSLP and IDBG-36507 and ENSG00000145777 and 85480, Tslp and IDBG-134008 and ENSMUSG00000024379 and 53603, cytokine activity, this GO :0005125 and cytokine activity and molecular function this GO :0005615 and extracellular space and cellular component, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity, thymic stromal lymphopoietin |
| Identity: |
30743 |
| Gene: |
TSLP |
More about : TSLP |
| Long gene name: |
thymic stromal lymphopoietin |
| Locus: |
5q22, 1 |
| Discovery year: |
2007-08-24 |
| GenBank acession: |
BC040592 |
| Entrez gene record: |
85480 |
| Pubmed identfication: |
11418668 11480573 |
| RefSeq identity: |
NM_033035 |
| Havana BLAST/BLAT: |
OTTHUMG00000128791 |