Recombinant Human Biliverdin Reductase A, BVR A (C-6His)

Contact us
Catalog number: CK04
Price: 332 €
Supplier: Bioss Primary Conjugated Antibodies.
Product name: Recombinant Human Biliverdin Reductase A, BVR A (C-6His)
Quantity: 100ul
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Biliverdin reductase A is produced by our E, coli expression system and the target gene encoding Glu6-Ser294 is expressed with a 6His tag at the C-terminus
Molecular Weight: 33, 8 kD
UniProt number: P53004
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 4 mM HCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVSHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: BVR A (C-6His), Biliverdin Reductase A
Short name: BVR A (C-6His), Recombinant Biliverdin Reductase A
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: BVR A (C-6His), sapiens Biliverdin Reductase A, recombinant H
Alternative technique: rec

Related Products :

MBS617284 Biliverdin IX alpha Reductase (BLVRA, Biliverdin reductase A, Biliverdin reductase A, BLVR, BVR, BVRA, BVR A) Antibody 100ug 735 € MBS Polyclonals_1 human
CK04 Recombinant Human Biliverdin Reductase A, BVR A (C-6His) 50 µg 369 € novo human
MBS613920 Biliverdin Reductase (BVR) Antibody 0.025 ml 348 € MBS Polyclonals_1 human
GWB-C5BEFB Recombinant Human Biliverdin Reductase A bulk Ask price € genways bulk human
GWB-E652EB Recombinant Human Biliverdin Reductase B bulk Ask price € genways bulk human
RP-0137H Recombinant Human BLVRB / biliverdin reductase B Protein (His Tag) 20μg 624 € adv human
abx166534 Anti-Biliverdin Reductase A Protein (Recombinant) 10 μg 369 € abbex human
abx166535 Anti-Biliverdin Reductase B Protein (Recombinant) 50 μg 572 € abbex human
GWB-P1661J Biliverdin reductase A, 3-296 aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-P0246L Biliverdin reductase B, 1-206aa, Recombinant Protein bulk Ask price € genways bulk human
abx573378 Anti-Human Biliverdin Reductase A (BLVRA) ELISA Kit inquire 50 € abbex human
abx252087 Anti-Human Biliverdin Reductase A ELISA Kit inquire 50 € abbex human
abx572773 Anti-Human Biliverdin Reductase B (BLVRB) ELISA Kit inquire 50 € abbex human
abx252088 Anti-Human Biliverdin Reductase B ELISA Kit inquire 50 € abbex human
DL-BLVRA-Hu Human Biliverdin Reductase A BLVRA ELISA Kit 96T 904 € DL elisas human
DL-BLVRB-Hu Human Biliverdin Reductase B BLVRB ELISA Kit 96T 904 € DL elisas human
AR09260PU-L anti-Biliverdin reductase A (3-296) Antibody 0,5 mg 833 € acr human
AR09260PU-N anti-Biliverdin reductase A (3-296) Antibody 0,1 mg 384 € acr human
abx128363 Anti-Biliverdin Reductase A Antibody 50 μg 412 € abbex human
abx128364 Anti-Biliverdin Reductase B Antibody 100 μg 514 € abbex human
GENTAUR-58be5cd7a45e1 Anti-BLVRA/Biliverdin Reductase, ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx573390 Anti-Rat Biliverdin Reductase A (BLVRA) ELISA Kit 96 tests 833 € abbex rat
EKU02723 Biliverdin Reductase A (BLVRA) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU02724 Biliverdin Reductase A (BLVRA) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
GWB-2C4F9C Biliverdin Reductase antibody 1 x 1 vial 648 € genways human
MBS611818 Biliverdin Reductase Antibody 100ul 619 € MBS Polyclonals_1 human
EKU02725 Biliverdin Reductase B (BLVRB) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
bs-12868R-A350 BLVRA/Biliverdin Reductase Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12868R-A488 BLVRA/Biliverdin Reductase Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12868R-A555 BLVRA/Biliverdin Reductase Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human