Recombinant Human Lymphocyte Activation Gene 3, LAG-3, CD223 (C-6His)

Contact us
Catalog number: CJ91
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Human Lymphocyte Activation Gene 3, LAG-3, CD223 (C-6His)
Quantity: 0.1ml
Other quantities: 1 mg 1674€ 10 µg 141€ 50 µg 303€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human LAG-3 is produced by our Mammalian expression system and the target gene encoding Leu23-Gly434 is expressed with a 6His tag at the C-terminus
Molecular Weight: 45, 5 kD
UniProt number: P18627
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD223 (C-6His), LAG-3, Lymphocyte Activation Gene 3
Short name: CD223 (C-6His), LAG-3, Recombinant Lymphocyte Activation Gene 3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD223 (C-6His), LAG-3, sapiens Lymphocyte Activation Gene 3, recombinant H
Alternative technique: rec
Identity: 6476
Gene: LAG3 | More about : LAG3
Long gene name: lymphocyte activating 3
Synonyms gene name: lymphocyte-activation gene 3
Synonyms: CD223
Locus: 12p13, 31
Discovery year: 1991-06-03
Entrez gene record: 3902
RefSeq identity: NM_002286
Classification: CD molecules Immunoglobulin like domain containing
Havana BLAST/BLAT: OTTHUMG00000169197

Related Products :

CJ91 Recombinant Human Lymphocyte Activation Gene 3, LAG-3, CD223 (C-6His) 1 mg 1674 € novo human
CK56 Recombinant Mouse Lymphocyte Activation Gene 3, LAG-3, CD223 (C-6His) 1 mg 1674 € novo mouse
MBS623650 LAG-3 (Lymphocyte Activation Gene 3 Protein, LAG3, CD223, FDC, Protein FDC) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624368 LAG3 (Lymphocyte Activation Gene 3 Protein, LAG-3, Protein FDC, CD223, FDC) (PerCP) Antibody 100 Tests 768 € MBS Polyclonals_1 human
RP-0976H Recombinant Human LAG3 / CD223 / Lymphocyte activation gene 3 Protein (Fc Tag) 50μg 624 € adv human
RP-0977H Recombinant Human LAG3 / CD223 / Lymphocyte activation gene 3 Protein (His Tag) 50μg 624 € adv human
RP-1384M Recombinant Mouse LAG3 / CD223 / Lymphocyte activation gene 3 Protein (His Tag) 50μg 624 € adv mouse
RP-2200R Recombinant Rat LAG3 / CD223 / Lymphocyte activation gene 3 Protein (His Tag) 50μg 624 € adv rat
MEDCLA901 Lymphocyte Activation Gene-3 Protein (LAG-3), Clone: 12H6, Mouse Monoclonal antibody-Human; paraffin, IH/No WB 1000ul 1230 € accurate-monoclonals human
CP56 Recombinant Rat T-lymphocyte Activation Antigen CD80, B7-1 (C-6His) 1 mg 2283 € novo rat
MBS619509 Activation-induced Cytidine Deaminase, CT (Activation Induced Cytidine Deaminase, Activation-induced Deaminase, AICDA, AID, ARP2, CDA2, Cytidine Aminohydrolase, HIGM2, Integrated into Burkitt's Lymphoma Cell Line Ramos) Antibody 100ug 591 € MBS Polyclonals_1 human
DL-LAG3-Hu Human Lymphocyte Activation Gene 3 LAG3 ELISA Kit 96T 788 € DL elisas human
GENTAUR-58be60e1d0f93 Anti-Lymphocyte Activation Gene 3, ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
GENTAUR-58bdca47d1c99 Anti- Lymphocyte Activation Gene 3 (LAG3) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdca4846306 Anti- Lymphocyte Activation Gene 3 (LAG3) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdcf3ed1369 Anti- Lymphocyte Activation Gene 3 (LAG3) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcf3f47d0d Anti- Lymphocyte Activation Gene 3 (LAG3) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdd19978bd7 Anti- Lymphocyte Activation Gene 3 (LAG3) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd3a79a725 Anti- Lymphocyte Activation Gene 3 (LAG3) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd6c7b6d54 Anti- Lymphocyte Activation Gene 3 (LAG3) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdd76f5202f Anti- Lymphocyte Activation Gene 3 (LAG3) Antibody 100ug 542 € MBS Polyclonals human
bs-2646R-A350 Lymphocyte Activation Gene 3 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2646R-A488 Lymphocyte Activation Gene 3 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2646R-A555 Lymphocyte Activation Gene 3 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2646R-A594 Lymphocyte Activation Gene 3 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2646R-A647 Lymphocyte Activation Gene 3 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2646R-Biotin Lymphocyte Activation Gene 3 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-2646R Lymphocyte Activation Gene 3 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-2646R-Cy3 Lymphocyte Activation Gene 3 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2646R-Cy5 Lymphocyte Activation Gene 3 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human