Recombinant Human Ephrin A Receptor 8, EphA8 (C-Fc)

Contact us
Catalog number: CJ80
Price: 663 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Ephrin A Receptor 8, EphA8 (C-Fc)
Quantity: 100ug
Other quantities: 10 µg 141€ 50 µg 303€ 500 µg 1115€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Ephrin A receptor 8 is produced by our Mammalian expression system and the target gene encoding Ala28-Leu495 is expressed with a Fc tag at the C-terminus
Molecular Weight: 4 kD, 78
UniProt number: P29322
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEVDESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRSVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSAAPAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDITYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSDLSPEPRRAAVVNITTNQAGRRRNSVPQRPGPPASPASDPSRDQSSAGDVLWAFRQVPLWPCAPHQDPELEALHCLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: EphA8 (C-Fc), Ephrin A Receptor 8
Short name: EphA8 (C-Fc), Recombinant Ephrin A Receptor 8
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: EphA8 (C-fragment c), sapiens Ephrin A Receptor 8, recombinant H
Alternative technique: rec

Related Products :

MBS618828 EphA8 (HEK3, EPA8, EEK, eph-, elk-related Tyrosine Kinase, Ephrin Receptor EphA8) Antibody 100ul 470 € MBS Polyclonals_1 human
MBS623300 EphA4 (Ephrin Receptor Eph A4, Ephrin Receptor EphA4, Ephrin Type A Receptor 4, EPH Receptor A4, Eph A4, EPH-like Kinase 8, EK8, HEK8, Receptor Protein Tyrosine Kinase HEK8, SEK, TYRO1 Protein Tyrosine Kinase, Tyrosine Protein Kinase Receptor SEK, Tyrosin Antibody 50ug 928 € MBS Polyclonals_1 human
CJ80 Recombinant Human Ephrin A Receptor 8, EphA8 (C-Fc) 50 µg 303 € novo human
MBS615500 Ephrin B3 (EFNB3, Ephrin B3 (EFL6, EPH-related receptor transmembrane ligand ELK-L3, EPH-related receptor tyrosine kinase ligand 8, Ephrin-B3, EPLG8, LERK8) Antibody 100ug 663 € MBS Polyclonals_1 human
GENTAUR-58bcac9083ab3 Mouse Ephrin type-A receptor 8 (Epha8) 100ug 2420 € MBS Recombinant Proteins mouse
GENTAUR-58bcac90cc2c3 Mouse Ephrin type-A receptor 8 (Epha8) 1000ug 2420 € MBS Recombinant Proteins mouse
GENTAUR-58bcac912a41c Mouse Ephrin type-A receptor 8 (Epha8) 100ug 2934 € MBS Recombinant Proteins mouse
GENTAUR-58bcac91638c7 Mouse Ephrin type-A receptor 8 (Epha8) 1000ug 2934 € MBS Recombinant Proteins mouse
MBS610892 Ephrin-A5 (ephrin-A5, AF1, AL-1, EFL5, EPH- related receptor tyrosine kinase ligand 7, Ephrin-A5 precursor, EPLG7, GLC1M, LERK7, LERK-7, RAGS) Antibody 50ug 625 € MBS Polyclonals_1 human
MBS613613 Ephrin-A5 (ephrin-A5, AF1, AL-1, EFL5, EPH- related receptor tyrosine kinase ligand 7, Ephrin-A5 precursor, EPLG7, GLC1M, LERK7, LERK-7, RAGS) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS611262 Ephrin B2 (EPH-related receptor tyrosine kinase ligand 5, Ephrin-B2, EFNB2, EPLG5, HTK-L, HTK ligand, LERK5) Antibody 100ug 464 € MBS Polyclonals_1 human
MBS614848 Ephrin B2 (EPH-related receptor tyrosine kinase ligand 5, Ephrin-B2, EFNB2, EPLG5, HTK-L, HTK ligand, LERK5) Antibody 100ug 464 € MBS Polyclonals_1 human
LV149577 EphA8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV149578 EphA8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV149579 EphA8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV149580 EphA8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV149582 EphA8 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV149581 EphA8 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58be1459d2e34 Anti- EPHA8 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be145a4fa6e Anti- EPHA8 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be652f191e9 Anti-EphA8 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx215186 Anti-EPHA8 (pT615) Antibody inquire 50 € abbex human
abx215185 Anti-EPHA8 (pT838) Antibody inquire 50 € abbex human
abx915516 Anti-EPHA8 siRNA 15 nmol 528 € abbex human
abx915517 Anti-EPHA8 siRNA 30 nmol 717 € abbex human
GENTAUR-58be2ba26ca40 EphA8 antibody 100ul 486 € MBS mono human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
PR27093-5 anti-Ephrin-A1 Ephrin-A1 / EFNA1 Antibody 5 Вµg 645 € acr human
AP06387PU-N anti-Ephrin-B1 (+Ephrin-B2) Antibody 0,1 mg 558 € acr human
MBS615633 Ephrin B1 (Ephrin-B1, ELK-L, EFL-3, Cek5-L, LERK-2) Antibody 100ug 663 € MBS Polyclonals_1 human