Recombinant Human Transforming Growth Factor β-2, TGFB2

Contact us
Catalog number: CJ79
Price: 745 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Human Transforming Growth Factor β-2, TGFB2
Quantity: 1 plate of 96 wells
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Transforming Growth Factor beta 2 is produced by our Mammalian expression system and the target gene encoding Ala303-Ser414 is expressed
Molecular Weight: 12, 7 kD
UniProt number: P61812
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 4 mM HCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TGFB2, -2, Transforming Growth Factor &beta
Short name: TGFB2, -2, Recombinant Transforming Growth Factor &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: b 2, sapiens Transforming Growth Factor &beta, transforming growth factor, -2, recombinant H
Alternative technique: rec
Alternative to gene target: Extracellular, LDS4 and TGF-beta2, TGFB2 and IDBG-106710 and ENSG00000092969 and 7042, TGFB2 and IDBG-629908 and ENSBTAG00000005359 and 534069, Tgfb2 and IDBG-208111 and ENSMUSG00000039239 and 21808, beta 2, protein heterodimerization activity, this GO :0000902 and cell morphogenesis and biological process this GO :0001501 and skeletal system development and biological process this GO :0001502 and cartilage condensation and biological process this GO :0001525 and angiogenesis and biological process this GO :0001540 and beta-amyloid binding and molecular function this GO :0001568 and blood vessel development and biological process this GO :0001654 and eye development and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001837 and epithelial to mesenchymal transition and biological process this GO :0001942 and hair follicle development and biological process this GO :0001974 and blood vessel remodeling and biological process this GO :0002576 and platelet degranulation and biological process this GO :0003007 and heart morphogenesis and biological process this GO :0004702 and receptor signaling protein serine/threonine kinase activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005114 and type II transforming growth factor beta receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005160 and transforming growth factor beta receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005768 and endosome and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007184 and SMAD protein import into nucleus and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007411 and axon guidance and biological process this GO :0007435 and salivary gland morphogenesis and biological process this GO :0007507 and heart development and biological process this GO :0007596 and blood coagulation and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008219 and cell death and biological process this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008347 and glial cell migration and biological process this GO :0009611 and response to wounding and biological process this GO :0009790 and embryo development and biological process this GO :0010002 and cardioblast differentiation and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010634 and positive regulation of epithelial cell migration and biological process this GO :0010693 and negative regulation of alkaline phosphatase activity and biological process this GO :0010718 and positive regulation of epithelial to mesenchymal transition and biological process this GO :0010936 and negative regulation of macrophage cytokine production and biological process this GO :0014068 and positive regulation of phosphatidylinositol 3-kinase signaling and biological process this GO :0016049 and cell growth and biological process this GO :0016477 and cell migration and biological process this GO :0022601 and menstrual cycle phase and biological process this GO :0023014 and signal transduction by phosphorylation and biological process this GO :0030097 and hemopoiesis and biological process this GO :0030168 and platelet activation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030199 and collagen fibril organization and biological process this GO :0030307 and positive regulation of cell growth and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030424 and axon and cellular component this GO :0030593 and neutrophil chemotaxis and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0031069 and hair follicle morphogenesis and biological process this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0032147 and activation of protein kinase activity and biological process this GO :0032570 and response to progesterone and biological process this GO :0032874 and positive regulation of stress-activated MAPK cascade and biological process this GO :0032909 and regulation of transforming growth factor beta2 production and biological process this GO :0033630 and positive regulation of cell adhesion mediated by integrin and biological process this GO :0040007 and growth and biological process this GO :0042060 and wound healing and biological process this GO :0042416 and dopamine biosynthetic process and biological process this GO :0042476 and odontogenesis and biological process this GO :0042493 and response to drug and biological process this GO :0042637 and catagen and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043525 and positive regulation of neuron apoptotic process and biological process this GO :0045216 and cell-cell junction organization and biological process this GO :0045726 and positive regulation of integrin biosynthetic process and biological process this GO :0045778 and positive regulation of ossification and biological process this GO :0045787 and positive regulation of cell cycle and biological process this GO :0045823 and positive regulation of heart contraction and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048103 and somatic stem cell division and biological process this GO :0048566 and embryonic digestive tract development and biological process this GO :0048663 and neuron fate commitment and biological process this GO :0048666 and neuron development and biological process this GO :0048699 and generation of neurons and biological process this GO :0050680 and negative regulation of epithelial cell proliferation and biological process this GO :0050714 and positive regulation of protein secretion and biological process this GO :0050777 and negative regulation of immune response and biological process this GO :0050778 and positive regulation of immune response and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :0051795 and positive regulation of catagen and biological process this GO :0051891 and positive regulation of cardioblast differentiation and biological process this GO :0060038 and cardiac muscle cell proliferation and biological process this GO :0060317 and cardiac epithelial to mesenchymal transition and biological process this GO :0060325 and face morphogenesis and biological process this GO :0060389 and pathway-restricted SMAD protein phosphorylation and biological process this GO :0070237 and positive regulation of activation-induced cell death of T cells and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :2001241 and positive regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0001540 : beta-amyloid binding, this GO :0001540 : beta-amyloid binding and also this GO :0004702 : receptor signaling protein serine/threonine kinase activity and also this GO :0005102 : receptor binding and also this GO :0005114 : type II transforming growth factor beta receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005160 : transforming growth factor beta receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0042803 : protein homodimerization activity and also this GO :0046982 : protein heterodimerization activity, this GO :0004702 : receptor signaling protein serine/threonine kinase activity, this GO :0005102 : receptor binding, this GO :0005114 : type II transforming growth factor beta receptor binding, this GO :0005125 : cytokine activity, this GO :0005160 : transforming growth factor beta receptor binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0042803 : protein homodimerization activity, this GO :0046982 : protein heterodimerization activity, transforming growth factor
Identity: 11768
Gene: TGFB2 | More about : TGFB2
Long gene name: transforming growth factor beta 2
Synonyms gene name: beta 2 , transforming growth factor
Synonyms name: prepro-transforming growth factor beta-2
Locus: 1q41
Discovery year: 1989-05-10
GenBank acession: M19154
Entrez gene record: 7042
RefSeq identity: NM_003238
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000039521

Related Products :

MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
CJ79 Recombinant Human Transforming Growth Factor β-2, TGFB2 500 µg 1613 € novo human
MBS621744 Transforming Growth Factor beta3 (Transforming Growth Factor beta 3, TGF beta 3, TGF beta3, TGFb3, ARVD, FLJ16571) Antibody 500ul 713 € MBS Polyclonals_1 human
CK35 Recombinant Mouse Transforming Growth Factor β-2, TGFβ2, TGFB2 10 µg 202 € novo human
MBS618947 Transforming Growth Factor beta2 Receptor (16CT) (TGFb2R, TGFBR2, Transforming growth factor, beta receptor II, AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2, TbetaR-II, TGFbeta-RII) 200ug 658 € MBS Polyclonals_1 human
MBS612691 Transforming Growth Factor beta2 Receptor (28NT) (TGFb2R, TGFBR2, Transforming Growth Factor beta Receptor II, AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2, TbetaR-II, TGFbeta-RII) Antibody 200ug 608 € MBS Polyclonals_1 human
DL-TGFb2-Hu Human Transforming Growth Factor Beta 2 TGFb2 ELISA Kit 96T 788 € DL elisas human
GENTAUR-58bdc45910fb5 Anti- Transforming Growth Factor Beta 2 (TGFb2) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc459885ce Anti- Transforming Growth Factor Beta 2 (TGFb2) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdd1738f448 Anti- Transforming Growth Factor Beta 2 (TGFb2) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd4b36fe59 Anti- Transforming Growth Factor Beta 2 (TGFb2) Antibody 100ug 553 € MBS Polyclonals human
DL-TGFb2-b Bovine Transforming Growth Factor Beta 2 TGFb2 ELISA Kit 96T 869 € DL elisas bovine
DL-TGFb2-c Canine Transforming Growth Factor Beta 2 TGFb2 ELISA Kit 96T 846 € DL elisas human
DL-TGFb2-Ch Chicken Transforming Growth Factor Beta 2 TGFb2 ELISA Kit 96T 788 € DL elisas chicken
GENTAUR-58b9eaac592f8 Chlorocebus aethiops Transforming growth factor beta-2 (TGFB2) 100ug 1398 € MBS Recombinant Proteins human
GENTAUR-58b9eaacba1ac Chlorocebus aethiops Transforming growth factor beta-2 (TGFB2) 1000ug 1398 € MBS Recombinant Proteins human
GENTAUR-58b9eaad1e083 Chlorocebus aethiops Transforming growth factor beta-2 (TGFB2) 100ug 1901 € MBS Recombinant Proteins human
GENTAUR-58b9eaaec97eb Chlorocebus aethiops Transforming growth factor beta-2 (TGFB2) 1000ug 1901 € MBS Recombinant Proteins human
DL-TGFb2-g Goat Transforming Growth Factor Beta 2 TGFb2 ELISA Kit 96T 904 € DL elisas human
DL-TGFb2-Si Monkey Transforming Growth Factor Beta 2 TGFb2 ELISA Kit 96T 904 € DL elisas monkey
DL-TGFb2-Mu Mouse Transforming Growth Factor Beta 2 TGFb2 ELISA Kit 96T 788 € DL elisas mouse
DL-TGFb2-p Porcine Transforming Growth Factor Beta 2 TGFb2 ELISA Kit 96T 869 € DL elisas porcine
DL-TGFb2-Rb Rabbit Transforming Growth Factor Beta 2 TGFb2 ELISA Kit 96T 788 € DL elisas human
DL-TGFb2-Ra Rat Transforming Growth Factor Beta 2 TGFb2 ELISA Kit 96T 788 € DL elisas rat
EKU07808 Transforming Growth Factor Beta 2 (TGFb2) ELISA kit 1 plate of 96 wells 883 € Biomatik ELISA kits human
EKU07809 Transforming Growth Factor Beta 2 (TGFb2) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
EKU07811 Transforming Growth Factor Beta 2 (TGFb2) ELISA kit 1 plate of 96 wells 764 € Biomatik ELISA kits human
EKU07812 Transforming Growth Factor Beta 2 (TGFb2) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
EKU07813 Transforming Growth Factor Beta 2 (TGFb2) ELISA kit 1 plate of 96 wells 943 € Biomatik ELISA kits human
EKU07814 Transforming Growth Factor Beta 2 (TGFb2) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human