Recombinant Human Transforming Growth Factor β-3, TGFB3

Contact us
Catalog number: CJ44
Price: 818 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Transforming Growth Factor β-3, TGFB3
Quantity: 50ug
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human/Mouse Transforming Growth Factor beta 3 is produced by our Mammalian expression system and the target gene encoding Ala301-Ser412(Tyr340Phe) is expressed
Molecular Weight: 12, 7 kD
UniProt number: P10600
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 4 mM HCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TGFB3, -3, Transforming Growth Factor &beta
Short name: TGFB3, -3, Recombinant Transforming Growth Factor &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: b 3, sapiens Transforming Growth Factor &beta, transforming growth factor, -3, recombinant H
Alternative technique: rec
Alternative to gene target: ARVD and ARVD1 and RNHF and TGF-beta3, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048286 and lung alveolus development and biological process this GO :0048565 and digestive tract development and biological process this GO :0048702 and embryonic neurocranium morphogenesis and biological process this GO :0048839 and inner ear development and biological process this GO :0050431 and transforming growth factor beta binding and molecular function this GO :0050714 and positive regulation of protein secretion and biological process this GO :0051491 and positive regulation of filopodium assembly and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :0060021 and palate development and biological process this GO :0060325 and face morphogenesis and biological process this GO :0060364 and frontal suture morphogenesis and biological process this GO :0060391 and positive regulation of SMAD protein import into nucleus and biological process this GO :0070483 and detection of hypoxia and biological process this GO :0071363 and cellular response to growth factor stimulus and biological process, TGFB3 and IDBG-13145 and ENSG00000119699 and 7043, TGFB3 and IDBG-646881 and ENSBTAG00000012004 and 538957, Tgfb3 and IDBG-159061 and ENSMUSG00000021253 and 21809, beta 3, nuclei, this GO :0000187 and activation of MAPK activity and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0002576 and platelet degranulation and biological process this GO :0005114 and type II transforming growth factor beta receptor binding and molecular function this GO :0005160 and transforming growth factor beta receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007184 and SMAD protein import into nucleus and biological process this GO :0007435 and salivary gland morphogenesis and biological process this GO :0007565 and female pregnancy and biological process this GO :0007568 and aging and biological process this GO :0007596 and blood coagulation and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008156 and negative regulation of DNA replication and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0009986 and cell surface and cellular component this GO :0010718 and positive regulation of epithelial to mesenchymal transition and biological process this GO :0010862 and positive regulation of pathway-restricted SMAD protein phosphorylation and biological process this GO :0010936 and negative regulation of macrophage cytokine production and biological process this GO :0016049 and cell growth and biological process this GO :0022601 and menstrual cycle phase and biological process this GO :0030141 and secretory granule and cellular component this GO :0030168 and platelet activation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030315 and T-tubule and cellular component this GO :0030501 and positive regulation of bone mineralization and biological process this GO :0030512 and negative regulation of transforming growth factor beta receptor signaling pathway and biological process this GO :0030879 and mammary gland development and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0032570 and response to progesterone and biological process this GO :0032967 and positive regulation of collagen biosynthetic process and biological process this GO :0034616 and response to laminar fluid shear stress and biological process this GO :0034713 and type I transforming growth factor beta receptor binding and molecular function this GO :0040007 and growth and biological process this GO :0042060 and wound healing and biological process this GO :0042476 and odontogenesis and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043025 and neuronal cell body and cellular component this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0043627 and response to estrogen and biological process this GO :0043932 and ossification involved in bone remodeling and biological process this GO :0045216 and cell-cell junction organization and biological process this GO :0045740 and positive regulation of DNA replication and biological process this GO :0045893 and positive regulation of transcription, this GO :0005114 : type II transforming growth factor beta receptor binding, this GO :0005114 : type II transforming growth factor beta receptor binding and also this GO :0005160 : transforming growth factor beta receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0034713 : type I transforming growth factor beta receptor binding and also this GO :0042802 : identical protein binding and also this GO :0046982 : protein heterodimerization activity and also this GO :0050431 : transforming growth factor beta binding, this GO :0005160 : transforming growth factor beta receptor binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0034713 : type I transforming growth factor beta receptor binding, this GO :0042802 : identical protein binding, this GO :0046982 : protein heterodimerization activity, this GO :0050431 : transforming growth factor beta binding, transforming growth factor beta binding, transforming growth factor
Identity: 11769
Gene: TGFB3 | More about : TGFB3
Long gene name: transforming growth factor beta 3
Synonyms gene: ARVD1 ARVD
Synonyms gene name: arrhythmogenic right ventricular dysplasia 1 transforming growth factor, beta 3
Synonyms name: prepro-transforming growth factor beta-3
Locus: 14q24
Discovery year: 1989-05-10
Entrez gene record: 7043
Pubmed identfication: 16549496 15639475
RefSeq identity: NM_003239
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000171489
Locus Specific Databases: ARVD/C Genetic Variants Database LRG_399

Related Products :

MBS621744 Transforming Growth Factor beta3 (Transforming Growth Factor beta 3, TGF beta 3, TGF beta3, TGFb3, ARVD, FLJ16571) Antibody 500ul 713 € MBS Polyclonals_1 human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
CJ44 Recombinant Human Transforming Growth Factor β-3, TGFB3 1 mg 2486 € novo human
DL-TGFb3-Hu Human Transforming Growth Factor Beta 3 TGFb3 ELISA Kit 96T 788 € DL elisas human
MBS618947 Transforming Growth Factor beta2 Receptor (16CT) (TGFb2R, TGFBR2, Transforming growth factor, beta receptor II, AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2, TbetaR-II, TGFbeta-RII) 200ug 658 € MBS Polyclonals_1 human
MBS612691 Transforming Growth Factor beta2 Receptor (28NT) (TGFb2R, TGFBR2, Transforming Growth Factor beta Receptor II, AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2, TbetaR-II, TGFbeta-RII) Antibody 200ug 608 € MBS Polyclonals_1 human
GENTAUR-58bdd6cf63815 Anti- Transforming Growth Factor Beta 3 (TGFb3) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd6fce654d Anti- Transforming Growth Factor Beta 3 (TGFb3) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd89a30a9e Anti- Transforming Growth Factor Beta 3 (TGFb3) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdd89a7d847 Anti- Transforming Growth Factor Beta 3 (TGFb3) Antibody 50ug 365 € MBS Polyclonals human
DL-TGFb3-c Canine Transforming Growth Factor Beta 3 TGFb3 ELISA Kit 96T 869 € DL elisas human
DL-TGFb3-Ch Chicken Transforming Growth Factor Beta 3 TGFb3 ELISA Kit 96T 846 € DL elisas chicken
DL-TGFb3-Eq Equine Transforming Growth Factor Beta 3 TGFb3 ELISA Kit 96T 916 € DL elisas human
DL-TGFb3-g Goat Transforming Growth Factor Beta 3 TGFb3 ELISA Kit 96T 916 € DL elisas human
DL-TGFb3-Gu Guinea pig Transforming Growth Factor Beta 3 TGFb3 ELISA Kit 96T 869 € DL elisas human
DL-TGFb3-Mu Mouse Transforming Growth Factor Beta 3 TGFb3 ELISA Kit 96T 788 € DL elisas mouse
DL-TGFb3-p Porcine Transforming Growth Factor Beta 3 TGFb3 ELISA Kit 96T 904 € DL elisas porcine
DL-TGFb3-Ra Rat Transforming Growth Factor Beta 3 TGFb3 ELISA Kit 96T 846 € DL elisas rat
EKU07815 Transforming Growth Factor Beta 3 (TGFb3) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU07816 Transforming Growth Factor Beta 3 (TGFb3) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
EKU07817 Transforming Growth Factor Beta 3 (TGFb3) ELISA kit 1 plate of 96 wells 930 € Biomatik ELISA kits human
EKU07818 Transforming Growth Factor Beta 3 (TGFb3) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
GWB-3AA62C Transforming Growth Factor B 3 (TGFB3) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 x 1 vial 648 € genways human
GWB-14B579 Transforming Growth Factor b3 (TGFb3), antibody 1 x 1 vial 406 € genways human
GWB-3DBE25 Transforming Growth Factor b3 (TGFb3), antibody 1 x 1 vial 568 € genways human
GWB-4C3C45 Transforming Growth Factor b3 (TGFb3), antibody 1 x 1 vial 324 € genways human
GWB-A453EF Transforming Growth Factor b3 (TGFb3), antibody 1 vial 637 € genways human
MBS622371 TGF beta-induced Factor 2 (Transforming Growth Factor beta-induced Factor 2, TGF (beta)-induced Transcription Factor 2, TGFB-induced Factor 2, TGIF2, 5'-TG-3' Interacting Factor 2, 5'-TG-3'-interacting Factor 2, Homeobox Protein TGIF2) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS621901 SHC-Transforming Protein 2 (Src Homology 2 Domain-Containing-Transforming Protein C2, SH2 Domain Protein C2, SHC-Transforming Protein B, Protein Sck, SHC2, SCK, SHCB) 100ug 752 € MBS Polyclonals_1 human
MBS623133 bTransforming Growth Factor beta2 Receptor (TGFb2R, TGFBR2, Transforming growth factor, beta receptor II, AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2, TbetaR-II, TGFbeta-RII) (Biotin) Antibody 50ug 818 € MBS Polyclonals_1 human