Recombinant Human GDNF Receptor α-2, GFRA2 (C-Fc-6His)

Contact us
Catalog number: CJ30
Price: 348 €
Supplier: MBS Polyclonals
Product name: Recombinant Human GDNF Receptor α-2, GFRA2 (C-Fc-6His)
Quantity: 0.12 ml
Other quantities: 10 µg 100€ 50 µg 156€ 500 µg 709€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Human GDNF Receptor alpha 2 is produced by our Mammalian expression system and the target gene encoding Ser22-Ser441 is expressed with a Fc
Molecular Weight: 7 kD, 74
UniProt number: O00451
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: GFRA2 (C-Fc-6His), -2, GDNF Receptor &alpha
Short name: GFRA2 (C-Fc-6His), -2, Recombinant GDNF Receptor &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: GFRA2 (C-fragment c-6His), sapiens glial cell derived neurotrophic factor Receptor &alpha, -2, recombinant H
Alternative technique: rec
Alternative to gene target: ATF1 and ATF2 and HFB1-GDNF and HSCR3, BT, Extracellular, GDNF and IDBG-17169 and ENSG00000168621 and 2668, Gdnf and IDBG-128378 and ENSMUSG00000022144 and 14573, protein homodimerization activity, this GO :0001656 and metanephros development and biological process this GO :0001657 and ureteric bud development and biological process this GO :0001658 and branching involved in ureteric bud morphogenesis and biological process this GO :0001755 and neural crest cell migration and biological process this GO :0001759 and organ induction and biological process this GO :0001941 and postsynaptic membrane organization and biological process this GO :0003337 and mesenchymal to epithelial transition involved in metanephros morphogenesis and biological process this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0007165 and signal transduction and biological process this GO :0007399 and nervous system development and biological process this GO :0007411 and axon guidance and biological process this GO :0007422 and peripheral nervous system development and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008344 and adult locomotory behavior and biological process this GO :0021784 and postganglionic parasympathetic nervous system development and biological process this GO :0030432 and peristalsis and biological process this GO :0031175 and neuron projection development and biological process this GO :0032770 and positive regulation of monooxygenase activity and biological process this GO :0033603 and positive regulation of dopamine secretion and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048255 and mRNA stabilization and biological process this GO :0048484 and enteric nervous system development and biological process this GO :0048485 and sympathetic nervous system development and biological process this GO :0051584 and regulation of dopamine uptake involved in synaptic transmission and biological process this GO :0060676 and ureteric bud formation and biological process this GO :0060688 and regulation of morphogenesis of a branching structure and biological process this GO :0072107 and positive regulation of ureteric bud formation and biological process this GO :0072108 and positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis and biological process this GO :0090190 and positive regulation of branching involved in ureteric bud morphogenesis and biological process this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0008083 : growth factor activity and also this GO :0042803 : protein homodimerization activity, this GO :0008083 : growth factor activity, this GO :0042803 : protein homodimerization activity, 58072 and IDBG-630047 and ENSBTAG00000005176 and 386587, glial cell derived neurotrophic factor
Identity: 4244
Gene: GFRA2 | More about : GFRA2
Long gene name: GDNF family receptor alpha 2
Synonyms: RETL2 GDNFRB NTNRA TRNR2
Locus: 8p21, 3
Discovery year: 1997-10-21
GenBank acession: AF002700
Entrez gene record: 2675
Pubmed identfication: 9177201
RefSeq identity: NM_001495
Havana BLAST/BLAT: OTTHUMG00000163897

Related Products :

C472 Recombinant Human GDNF Receptor α-2, GFRA2 (C-6His) 10 µg 90 € novo human
CJ30 Recombinant Human GDNF Receptor α-2, GFRA2 (C-Fc-6His) 10 µg 100 € novo human
MBS622722 GFR alpha1 (Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 1, GDNF Family Receptor alpha 1, GDNF Receptor alpha 1, GFR-alpha-1, GFRalpha1, GFRA1, GDNF Receptor alpha, GDNFR alpha, GDNFR-alpha, GDNFRa, GDNFR, GPI-linked Anchor Protein, MGC23045 Antibody 100ug 857 € MBS Polyclonals_1 human
GENTAUR-58bca28cbb4f8 Human GDNF family receptor alpha-2 (GFRA2) 100ug 2188 € MBS Recombinant Proteins human
GENTAUR-58bca28d0cdb5 Human GDNF family receptor alpha-2 (GFRA2) 1000ug 2188 € MBS Recombinant Proteins human
GENTAUR-58bca28d5423d Human GDNF family receptor alpha-2 (GFRA2) 100ug 2702 € MBS Recombinant Proteins human
GENTAUR-58bca28d8b740 Human GDNF family receptor alpha-2 (GFRA2) 1000ug 2702 € MBS Recombinant Proteins human
C471 Recombinant Human GDNF Family Receptor α-1, GFRA1 (C-6His) 10 µg 90 € novo human
CD08 Recombinant Human Glial Cell Line-Derived Neurotrophic Factor, GDNF (C-Fc-6His) 10 µg 156 € novo human
RP-0740H Recombinant Human GFRA2 / GDNFRB Protein (His Tag) 100μg 624 € adv human
CD55 Recombinant Human GDNF Family Receptor α-1, GFRA1 (C-Fc) 1 mg 1115 € novo human
RP-1307M Recombinant Mouse GFRA2 / GFRα2 / GDNFRB Protein (His Tag) 100μg 659 € adv human
MBS615826 GFRa2 (GFRalpha2, Neurturin Receptor) Antibody 100ug 608 € MBS Polyclonals_1 human
MBS619896 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX Receptor beta, LXRa, LXR-a, LXRalpha, LXRb, LXR-b, LXRbeta, NERI, NER-I, NR1H2, NR1H3, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 100ug 763 € MBS Polyclonals_1 human
MBS611189 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX receptor beta, LXRa, LXRalpha, LXRb, LXRbeta, NERI, NR1H2, NR1H3, Nuclear Orphan Receptor LXR alpha, Nuclear Orphan Receptor LXR beta, Nuclear Receptor Antibody 100ug 735 € MBS Polyclonals_1 human
abx260723 Anti-GDNF Family Receptor alpha 3 Protein (Recombinant) 20 µg 340 € abbex human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
LV168407 GFRA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV168408 GFRA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV168409 GFRA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV168410 GFRA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV168412 GFRA2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV168411 GFRA2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
abx251581 Anti-Human GDNF family receptor alpha 1 ELISA Kit 96 tests 659 € abbex human
GENTAUR-58b8a1aab1254 Human GDNF family receptor alpha-3 (GFRA3) 100ug 1978 € MBS Recombinant Proteins human
GENTAUR-58b8a1aaeed9e Human GDNF family receptor alpha-3 (GFRA3) 1000ug 1978 € MBS Recombinant Proteins human
GENTAUR-58b8a1abb7ada Human GDNF family receptor alpha-3 (GFRA3) 100ug 2492 € MBS Recombinant Proteins human
GENTAUR-58b8a1ac3795b Human GDNF family receptor alpha-3 (GFRA3) 1000ug 2492 € MBS Recombinant Proteins human
GENTAUR-58bdea5890dfb Anti- GFRA2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdea58e69ff Anti- GFRA2 Antibody 0.12 ml 348 € MBS Polyclonals human