| Catalog number: | CI99 |
|---|---|
| Price: | 2929 € |
| Supplier: | MBS Recombinant Proteins |
| Product name: | Recombinant Human Cryptic Protein (C-6His) |
| Quantity: | 1000ug |
| Other quantities: | 10 µg 146€ 50 µg 303€ 500 µg 1613€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Cryptic is produced by our Mammalian expression system and the target gene encoding Met1-Gly169 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: | 19, 9 kD |
| UniProt number: | P0CG37 |
| State of the product: | Freeze-dried |
| Shipping conditions: | Ambient temperature |
| Formulation: | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYSRAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRRSECGALEHGAWTLRACHLCRCIFGALHCLPLQTPDRCDPKDFLASHAHGVDHHHHHH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | Cryptic Protein (C-6His) |
| Short name: | Recombinant Cryptic Protein (C-6His) |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | sapiens Cryptic Protein (C-6His), recombinant H |
| Alternative technique: | rec |
| CI99 | Recombinant Human Cryptic Protein (C-6His) | 10 µg | 146 € | novo | human |
| abx251141 | Anti-Human Cryptic protein ELISA Kit | inquire | 50 € | abbex | human |
| GENTAUR-58bc48616cad4 | Human Cryptic protein (CFC1) | 100ug | 1453 € | MBS Recombinant Proteins | human |
| GENTAUR-58bc4861b5570 | Human Cryptic protein (CFC1) | 1000ug | 1453 € | MBS Recombinant Proteins | human |
| GENTAUR-58bc4862289a1 | Human Cryptic protein (CFC1) | 100ug | 1956 € | MBS Recombinant Proteins | human |
| GENTAUR-58bc4862779f4 | Human Cryptic protein (CFC1) | 1000ug | 1956 € | MBS Recombinant Proteins | human |
| 101-M344 | Anti-Human Cryptic | 100ug | 336 € | Reliatech antibodies | human |
| MBS248461 | PAb (IgG) to Human CRYPTIC | 100ul | 597 € | MBS Polyclonals_1 | human |
| AP32926PU-N | anti-Cryptic protein Antibody | 0,1 mg | 558 € | acr | human |
| GENTAUR-58bcbcae4638e | Cryptic plasmid protein A (cppA) | 100ug | 1326 € | MBS Recombinant Proteins | human |
| GENTAUR-58bcbcae7e779 | Cryptic plasmid protein A (cppA) | 1000ug | 1326 € | MBS Recombinant Proteins | human |
| GENTAUR-58bcbcaec03da | Cryptic plasmid protein A (cppA) | 100ug | 1829 € | MBS Recombinant Proteins | human |
| GENTAUR-58bcbcaf13fa5 | Cryptic plasmid protein A (cppA) | 1000ug | 1829 € | MBS Recombinant Proteins | human |
| GENTAUR-58bcfa38021c1 | Cryptic plasmid protein B (cppB) | 100ug | 1647 € | MBS Recombinant Proteins | human |
| GENTAUR-58bcfa385168d | Cryptic plasmid protein B (cppB) | 1000ug | 1647 € | MBS Recombinant Proteins | human |
| GENTAUR-58bcfa38966a1 | Cryptic plasmid protein B (cppB) | 100ug | 2161 € | MBS Recombinant Proteins | human |
| GENTAUR-58bcfa38dfe22 | Cryptic plasmid protein B (cppB) | 1000ug | 2161 € | MBS Recombinant Proteins | human |
| GENTAUR-58bdcba6a3c27 | Anti- Cripto, FRL1, Cryptic Family 1 (CFC1) Antibody | 100ug | 525 € | MBS Polyclonals | human |
| GENTAUR-58bdcba71ce19 | Anti- Cripto, FRL1, Cryptic Family 1 (CFC1) Antibody | 50ug | 398 € | MBS Polyclonals | human |
| GENTAUR-58bdd2af13c0e | Anti- Cripto, FRL1, Cryptic Family 1 (CFC1) Antibody | 100ug | 569 € | MBS Polyclonals | human |
| GENTAUR-58bdd8095c3f5 | Anti- Cripto, FRL1, Cryptic Family 1 (CFC1) Antibody | 100ug | 608 € | MBS Polyclonals | human |
| 103-M350 | Anti-Mouse Cryptic | 100ug | 336 € | Reliatech antibodies | mouse |
| GENTAUR-58b857917f0ea | Cryptic phage CTXphi transcriptional repressor rstR (rstR) | 100ug | 1398 € | MBS Recombinant Proteins | human |
| GENTAUR-58b85791c0f38 | Cryptic phage CTXphi transcriptional repressor rstR (rstR) | 1000ug | 1398 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8579226db1 | Cryptic phage CTXphi transcriptional repressor rstR (rstR) | 100ug | 1901 € | MBS Recombinant Proteins | human |
| GENTAUR-58b85792823ee | Cryptic phage CTXphi transcriptional repressor rstR (rstR) | 1000ug | 1901 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba73751dd99 | Escherichia coli Cryptic outer membrane porin BglH (bglH) | 100ug | 2415 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba7375a041a | Escherichia coli Cryptic outer membrane porin BglH (bglH) | 1000ug | 2415 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba73762f491 | Escherichia coli Cryptic outer membrane porin BglH (bglH) | 100ug | 2929 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba7376d9227 | Escherichia coli Cryptic outer membrane porin BglH (bglH) | 1000ug | 2929 € | MBS Recombinant Proteins | human |