Recombinant Human Cryptic Protein (C-6His)

Contact us
Catalog number: CI99
Price: 2929 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Cryptic Protein (C-6His)
Quantity: 1000ug
Other quantities: 10 µg 146€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cryptic is produced by our Mammalian expression system and the target gene encoding Met1-Gly169 is expressed with a 6His tag at the C-terminus
Molecular Weight: 19, 9 kD
UniProt number: P0CG37
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYSRAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRRSECGALEHGAWTLRACHLCRCIFGALHCLPLQTPDRCDPKDFLASHAHGVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Cryptic Protein (C-6His)
Short name: Recombinant Cryptic Protein (C-6His)
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens Cryptic Protein (C-6His), recombinant H
Alternative technique: rec

Related Products :

CI99 Recombinant Human Cryptic Protein (C-6His) 10 µg 146 € novo human
abx251141 Anti-Human Cryptic protein ELISA Kit inquire 50 € abbex human
GENTAUR-58bc48616cad4 Human Cryptic protein (CFC1) 100ug 1453 € MBS Recombinant Proteins human
GENTAUR-58bc4861b5570 Human Cryptic protein (CFC1) 1000ug 1453 € MBS Recombinant Proteins human
GENTAUR-58bc4862289a1 Human Cryptic protein (CFC1) 100ug 1956 € MBS Recombinant Proteins human
GENTAUR-58bc4862779f4 Human Cryptic protein (CFC1) 1000ug 1956 € MBS Recombinant Proteins human
101-M344 Anti-Human Cryptic 100ug 336 € Reliatech antibodies human
MBS248461 PAb (IgG) to Human CRYPTIC 100ul 597 € MBS Polyclonals_1 human
AP32926PU-N anti-Cryptic protein Antibody 0,1 mg 558 € acr human
GENTAUR-58bcbcae4638e Cryptic plasmid protein A (cppA) 100ug 1326 € MBS Recombinant Proteins human
GENTAUR-58bcbcae7e779 Cryptic plasmid protein A (cppA) 1000ug 1326 € MBS Recombinant Proteins human
GENTAUR-58bcbcaec03da Cryptic plasmid protein A (cppA) 100ug 1829 € MBS Recombinant Proteins human
GENTAUR-58bcbcaf13fa5 Cryptic plasmid protein A (cppA) 1000ug 1829 € MBS Recombinant Proteins human
GENTAUR-58bcfa38021c1 Cryptic plasmid protein B (cppB) 100ug 1647 € MBS Recombinant Proteins human
GENTAUR-58bcfa385168d Cryptic plasmid protein B (cppB) 1000ug 1647 € MBS Recombinant Proteins human
GENTAUR-58bcfa38966a1 Cryptic plasmid protein B (cppB) 100ug 2161 € MBS Recombinant Proteins human
GENTAUR-58bcfa38dfe22 Cryptic plasmid protein B (cppB) 1000ug 2161 € MBS Recombinant Proteins human
GENTAUR-58bdcba6a3c27 Anti- Cripto, FRL1, Cryptic Family 1 (CFC1) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdcba71ce19 Anti- Cripto, FRL1, Cryptic Family 1 (CFC1) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdd2af13c0e Anti- Cripto, FRL1, Cryptic Family 1 (CFC1) Antibody 100ug 569 € MBS Polyclonals human
GENTAUR-58bdd8095c3f5 Anti- Cripto, FRL1, Cryptic Family 1 (CFC1) Antibody 100ug 608 € MBS Polyclonals human
103-M350 Anti-Mouse Cryptic 100ug 336 € Reliatech antibodies mouse
GENTAUR-58b857917f0ea Cryptic phage CTXphi transcriptional repressor rstR (rstR) 100ug 1398 € MBS Recombinant Proteins human
GENTAUR-58b85791c0f38 Cryptic phage CTXphi transcriptional repressor rstR (rstR) 1000ug 1398 € MBS Recombinant Proteins human
GENTAUR-58b8579226db1 Cryptic phage CTXphi transcriptional repressor rstR (rstR) 100ug 1901 € MBS Recombinant Proteins human
GENTAUR-58b85792823ee Cryptic phage CTXphi transcriptional repressor rstR (rstR) 1000ug 1901 € MBS Recombinant Proteins human
GENTAUR-58ba73751dd99 Escherichia coli Cryptic outer membrane porin BglH (bglH) 100ug 2415 € MBS Recombinant Proteins human
GENTAUR-58ba7375a041a Escherichia coli Cryptic outer membrane porin BglH (bglH) 1000ug 2415 € MBS Recombinant Proteins human
GENTAUR-58ba73762f491 Escherichia coli Cryptic outer membrane porin BglH (bglH) 100ug 2929 € MBS Recombinant Proteins human
GENTAUR-58ba7376d9227 Escherichia coli Cryptic outer membrane porin BglH (bglH) 1000ug 2929 € MBS Recombinant Proteins human