Recombinant Human Methylmalonyl-CoA Epimerase, MCEE (C-6His)

Contact us
Catalog number: CI82
Price: 1138 €
Supplier: acr
Product name: Recombinant Human Methylmalonyl-CoA Epimerase, MCEE (C-6His)
Quantity: 0,5 mg
Other quantities: 1 mg 1115€ 500 µg 780€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Methylmalonyl-CoA epimerase is produced by our Mammalian expression system and the target gene encoding Gln37-Ala176 is expressed with a 6His tag at the C-terminus
Molecular Weight: 16 kD
UniProt number: Q96PE7
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 1 mM DTT, 10%Glycerol, 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, 5, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGLDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQALDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MCEE (C-6His), Methylmalonyl-CoA Epimerase
Short name: MCEE (C-6His), Recombinant Methylmalonyl-CoA Epimerase
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: MCEE (C-6His), sapiens Methylmalonyl-CoA Epimerase, recombinant H
Alternative technique: rec
Identity: 16732
Gene: MCEE | More about : MCEE
Long gene name: methylmalonyl-CoA epimerase
Synonyms: GLOD2
Synonyms name: glyoxalase domain containing 2
Locus: 2p13, 3
Discovery year: 2001-10-03
GenBank acession: AF364547
Entrez gene record: 84693
Pubmed identfication: 16697227 16752391 16843692
RefSeq identity: NM_032601
Havana BLAST/BLAT: OTTHUMG00000129709
Locus Specific Databases: MCEE database at LOVD-China

Related Products :

CI82 Recombinant Human Methylmalonyl-CoA Epimerase, MCEE (C-6His) 1 mg 1115 € novo human
AE34046MO-48 ELISA test for Mouse Methylmalonyl-CoA epimerase, mitochondrial (MCEE) 1x plate of 48 wells 373 € abebio mouse
AE34046MO Mouse Methylmalonyl-CoA epimerase, mitochondrial (MCEE) ELISA Kit 48 wells plate 480 € ab-elisa elisas mouse
AE34046MO-96 Mouse Methylmalonyl-CoA epimerase, mitochondrial (MCEE) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
MBS617469 a-Methylacyl CoA Racemase (Alpha Methylacyl CoA Racemase, Alpha Methylacyl Coenzyme A Racemase, AMACR, 2-Arylpropionyl CoA Epimerase, 2-Methylacyl CoA Racemase, EC 5.1.99.4, Macr1, Methylacyl CoA Racemase alpha, P504S, RACE) Antibody 500ul 696 € MBS Polyclonals_1 human
GENTAUR-58ba4d00d9b37 Bacillus pseudofirmus Methylmalonyl-CoA mutase homolog 100ug 1487 € MBS Recombinant Proteins human
GENTAUR-58ba4d016d267 Bacillus pseudofirmus Methylmalonyl-CoA mutase homolog 1000ug 1487 € MBS Recombinant Proteins human
GENTAUR-58ba4d026a0a8 Bacillus pseudofirmus Methylmalonyl-CoA mutase homolog 100ug 1989 € MBS Recombinant Proteins human
GENTAUR-58ba4d02df99c Bacillus pseudofirmus Methylmalonyl-CoA mutase homolog 1000ug 1989 € MBS Recombinant Proteins human
GENTAUR-58b8e84d4d9e2 Escherichia coli Methylmalonyl-CoA decarboxylase (scpB) 100ug 1768 € MBS Recombinant Proteins human
GENTAUR-58b8e84da3dae Escherichia coli Methylmalonyl-CoA decarboxylase (scpB) 1000ug 1768 € MBS Recombinant Proteins human
GENTAUR-58b8e84dd316f Escherichia coli Methylmalonyl-CoA decarboxylase (scpB) 100ug 2282 € MBS Recombinant Proteins human
GENTAUR-58b8e84e3d3c7 Escherichia coli Methylmalonyl-CoA decarboxylase (scpB) 1000ug 2282 € MBS Recombinant Proteins human
GENTAUR-58b9e47c582ae Escherichia coli Methylmalonyl-CoA decarboxylase (scpB) 100ug 1768 € MBS Recombinant Proteins human
GENTAUR-58b9e47cc8423 Escherichia coli Methylmalonyl-CoA decarboxylase (scpB) 1000ug 1768 € MBS Recombinant Proteins human
GENTAUR-58b9e47d2acae Escherichia coli Methylmalonyl-CoA decarboxylase (scpB) 100ug 2282 € MBS Recombinant Proteins human
GENTAUR-58b9e47d5ed42 Escherichia coli Methylmalonyl-CoA decarboxylase (scpB) 1000ug 2282 € MBS Recombinant Proteins human
GENTAUR-58bc3c1ea5882 Escherichia coli Methylmalonyl-CoA mutase (scpA) 100ug 2934 € MBS Recombinant Proteins human
GENTAUR-58bc3c1f07850 Escherichia coli Methylmalonyl-CoA mutase (scpA) 1000ug 2934 € MBS Recombinant Proteins human
GENTAUR-58bc3c1f5dcb7 Escherichia coli Methylmalonyl-CoA mutase (scpA) 100ug 3398 € MBS Recombinant Proteins human
GENTAUR-58bc3c1fa9ffd Escherichia coli Methylmalonyl-CoA mutase (scpA) 1000ug 3398 € MBS Recombinant Proteins human
GWB-P1286L MCEE, 37-176aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BSP173 MCEE Human Protein bulk Ask price € genways bulk human
LV215949 MCEE Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV215950 MCEE Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV215951 MCEE Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV215952 MCEE Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV215954 MCEE Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV215953 MCEE Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
AR09690PU-L anti-MCEE (37-176, His-tag) Antibody 0,5 mg 1138 € acr human